PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa003855
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 313aa    MW: 34519.1 Da    PI: 5.6189
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58684111PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-37832PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.32e-29152205155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                +prl Wtp+LH+rFv++v++L G ++A+Pkti++ m+v+gLt+e+v+SHLQkYRl
  Lsa003855 152 RPRLAWTPQLHKRFVDVVAHL-GVKNAVPKTIMQWMNVEGLTRENVASHLQKYRL 205
                59*******************.9*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.465149208IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-29149210IPR009057Homeodomain-like
SuperFamilySSF466898.24E-19150210IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-22153205IPR006447Myb domain, plants
PfamPF002491.0E-7154204IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGEEVRITGY DVGGGDEHDG RVLEWEAGLP NIDDLMPLSQ SMTSADFLSA FSISPEPYRS  60
MFDVNRASQN TISNLRGELE QQSLNKLNSL KSFGDYDKGD EMVVEGDETT DLTRGASDLQ  120
KLQRIDDGGG AGEEIDSALL ADDDSSARAS KRPRLAWTPQ LHKRFVDVVA HLGVKNAVPK  180
TIMQWMNVEG LTRENVASHL QKYRLYLKRM HIQGPSSSDH LFASTPVPQN LHESGAGGTV  240
NGHHHAPGAI PMHYHSQMVS MPYPSPQMDP NSAGGDGGGA YHHGFESHSY PYNMTTQQRD  300
WSAYQHHMTS NDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-20149210263ARR10-B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002283159.12e-99PREDICTED: transcription factor PCL1
RefseqXP_010650997.12e-99PREDICTED: transcription factor PCL1
RefseqXP_010650998.12e-99PREDICTED: transcription factor PCL1
SwissprotQ9SNB44e-66PCL1_ARATH; Transcription factor LUX
TrEMBLA0A103Y6X21e-148A0A103Y6X2_CYNCS; Homeodomain-like protein
STRINGVIT_06s0004g05120.t015e-99(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.24e-63G2-like family protein