PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa002976
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family B3
Protein Properties Length: 579aa    MW: 65173.1 Da    PI: 5.3601
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58691115PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-5456387PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B342.89.7e-14451241598
                -EE--HHH.HTT..---..--SEEEEEETTS.-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
         B3  15 rlvlpkkfaeeh..ggkkeesktltledesg.rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                rl lp  f+++h  ++    +   +l++++g  +W++k+  +k ++ y +t+GW++ v++ +L  gDf+vF l+++s+f  ++++f+
  Lsa002976  45 RLDLPSGFIRRHleNK---IPENPILRSRNGgYEWRLKI--KKEGEIYCFTDGWSDVVEDSELGFGDFLVFWLVDESTF--KFSIFS 124
                699*********7433...44456778855549******..999999**************************998988..888886 PP

2B358.21.4e-182373161093
                HHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
         B3  10 vlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                 + +  ++lp +fa+   ++ e+   +++++ +g++W+++l  +  s+ry+l++GW+eF + n+L+egD +vFk+++++++ ++
  Lsa002976 237 KGHTMSMRLPSEFARLARIDAER--SVIMKNIDGQEWKIRL--QSDSKRYYLSAGWSEFRRVNELCEGDKCVFKFIKSEDKLCL 316
                34455699******888888766..5***************..********************************997665444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019368.04E-1930133IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.7631126IPR003340B3 DNA binding domain
CDDcd100173.07E-1632124No hitNo description
SMARTSM010199.7E-1734126IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.3E-1644136IPR015300DNA-binding pseudobarrel domain
PfamPF023622.5E-1145124IPR003340B3 DNA binding domain
SuperFamilySSF1019361.0E-18226317IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.5E-18227311IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.254228322IPR003340B3 DNA binding domain
CDDcd100171.11E-15229316No hitNo description
SMARTSM010198.2E-15231322IPR003340B3 DNA binding domain
PfamPF023621.5E-15235314IPR003340B3 DNA binding domain
PRINTSPR009291.4E-6337347IPR017956AT hook, DNA-binding motif
PRINTSPR009291.4E-6408419IPR017956AT hook, DNA-binding motif
SMARTSM003849.1410422IPR017956AT hook, DNA-binding motif
PRINTSPR009291.4E-6441451IPR017956AT hook, DNA-binding motif
SMARTSM0038458443455IPR017956AT hook, DNA-binding motif
SMARTSM003846.3542554IPR017956AT hook, DNA-binding motif
SMARTSM00384490569579IPR017956AT hook, DNA-binding motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 579 aa     Download sequence    Send to blast
XCIGQVRAAI SIPLSQFQPS AVCKIMALRP LPSFYKILLD RSAPRLDLPS GFIRRHLENK  60
IPENPILRSR NGGYEWRLKI KKEGEIYCFT DGWSDVVEDS ELGFGDFLVF WLVDESTFKF  120
SIFSPNGCER DFPSQIQVKN DDHDEVEEQD AEQEEEELEV EDGVEDDEEE AAEEDDEDEE  180
EEEEEEDSEE EEDDIFDDGG VDEEEDAGDE DDDGDGGGDV DVDGDDGDPY FMTIMSKGHT  240
MSMRLPSEFA RLARIDAERS VIMKNIDGQE WKIRLQSDSK RYYLSAGWSE FRRVNELCEG  300
DKCVFKFIKS EDKLCLAKVT KKRVQSKQPP PVEVLKKRSR GQPPPPRVEV QPKQSTGKAQ  360
APVAEVLKRS RGKPQPPPSR VVVESKDDVR EVVNEKQPAE KVPPAAEVSK RPRGRPPRVQ  420
VVVEEKGRSK NPAEKAPEVE VSKRLRGRPP RVEVVVEKKG RSKKSAGKAP AAEISKRLRC  480
RPLHVEVVAE EKGRSKKPVG KAPAAEVSKM LRRRPPRVEV AVEKKVQSKK PAGKAPADEV  540
LKRKRGRPSH VEVEGGKSVV KRSPGRPFKR KRGRPASGS
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60130.22e-09B3 family protein