PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa002652
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family SBP
Protein Properties Length: 403aa    MW: 44263.1 Da    PI: 8.3245
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-54303PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.76.2e-4285162178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +C v+gC+adls++keyhrrhkvCe+hsk+++v ++g++qrfCqqCsrfh+l+efDe+krsCr+rL++hn+rrrk+q+
  Lsa002652  85 TCLVDGCNADLSNCKEYHRRHKVCEIHSKTAQVSINGQKQRFCQQCSRFHSLEEFDEGKRSCRKRLDGHNRRRRKPQP 162
                5**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114132.16383160IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.7E-3383147IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.27E-3884164IPR004333Transcription factor, SBP-box
PfamPF031104.5E-3186159IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MDWNLKIPSW DFTEFEQGTI PNIDSTSGSS SYGGQGIKGN FCVDLKLGQV IDSGNELKST  60
SKMALSPSAS SKRARPINNT IPAATCLVDG CNADLSNCKE YHRRHKVCEI HSKTAQVSIN  120
GQKQRFCQQC SRFHSLEEFD EGKRSCRKRL DGHNRRRRKP QPDTSRSASL FSGHQGATML  180
QFSSPHVYQT TSLTNHLWTT MVKSEEQTYS TRHSTMAHKH NPFPESSLGG KKLPGKQQFS  240
LFHGSHLKLN HQTSPPKVSQ QSQSQTQPQT VVTFEGNSSG SYEKLFCDGY PPPAAAARVV  300
QPVVQSSDCA LSLLSSSPSQ TSCTTLSHVM HPSNSYGAPP NPMDPGAGAG YGGLESIMDP  360
NGNGNDCDGM IQMGIHHHHH HQHQHQHASP DNGAPQTLPF YWE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-29861591184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1142159KRSCRKRLDGHNRRRRKP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023741902.10.0squamosa promoter-binding-like protein 13A
RefseqXP_023741903.10.0squamosa promoter-binding-like protein 13A
TrEMBLA0A2J6JXU50.0A0A2J6JXU5_LACSA; Uncharacterized protein
STRINGEMJ104051e-99(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-57SBP family protein