PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa002401
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 405aa    MW: 45125.5 Da    PI: 4.9374
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58690172PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-11707PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.57.5e-34199253155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                kpr+rWtpeLHe+Fveav+qLGGse+AtPk +l+lm++++Lt++hvkSHLQkYR+
  Lsa002401 199 KPRMRWTPELHESFVEAVNQLGGSERATPKGVLKLMNIESLTIYHVKSHLQKYRT 253
                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.527196256IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-31197255IPR009057Homeodomain-like
SuperFamilySSF466896.09E-18198253IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-24199253IPR006447Myb domain, plants
PfamPF002491.1E-9201252IPR001005SANT/Myb domain
PfamPF143791.7E-22287332IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MDITPVCLKQ SGEKQLNDHM GVSRAMSSSN PVIPGFEGKY KKISDSIINT NTLFPDQNQI  60
VVSADTMSSF QTSNFVNSQS MSLIGYTSQT DDISWTAESL KDLIDFPENV AGNNVAGSSL  120
IPASDHGGGR GTDWQNWADQ LMSVDDTIDP NWNDIMADVD VPTLDTTKQM QIIPRPQVPS  180
IEVCPVSSPS SNGASSSIKP RMRWTPELHE SFVEAVNQLG GSERATPKGV LKLMNIESLT  240
IYHVKSHLQK YRTARYKPEL SEGTSDKKAT SIDEMVAMDI KNKSLGFTDA LKLQMEVQKQ  300
LHEQLEIQRN LQLRIEEQGK YLQMMFEQQR KMENGRLKPS SSNQDEEDDP ATEKQKASKN  360
DDRCEKSKEK SNSQIEVPEV NKSNMESGCS PRPSKRARPD EASMA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011102128.11e-109PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_011102186.11e-109PREDICTED: protein PHR1-LIKE 1-like isoform X2
SwissprotQ8GUN51e-76PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLF6H5X91e-102F6H5X9_VITVI; Putative uncharacterized protein
STRINGVIT_14s0036g01380.t011e-102(Vitis vinifera)