PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa002359
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family NF-YA
Protein Properties Length: 300aa    MW: 32824 Da    PI: 9.1205
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58680330PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA91.51.1e-28153209158
  CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                d p++VNaKQy++I++RR +Rak+e  kk   k+rkpylh SRh hA+rRpRg+gGrF
  Lsa002359 153 DGPIFVNAKQYHGIIRRRRSRAKAEMAKKA-PKGRKPYLHLSRHLHAKRRPRGCGGRF 209
                57************************9999.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.0E-30151212IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115233.131152212IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.9E-21155177IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.4E-24155209IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860157177IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.9E-21186209IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MNSAYYKQHE DGIASNPVGS LSSGSGPWWS GLATQSTFEE SVGRMKLSSM ENCGEQLMPI  60
APKPSSHSTD QGNTTHFNTF PGDCKNSSKG QKPVQFEAAF SHEYGGQLEL GFGQPAVICG  120
KYTYGDQYYG MISGCGPQIT GRIMLPLNLS TDDGPIFVNA KQYHGIIRRR RSRAKAEMAK  180
KAPKGRKPYL HLSRHLHAKR RPRGCGGRFL NTKEMEKGNV GILDSKTTEH PIDSQRSEVL  240
QSDHEMNASR PHISGSEVTS MFSMGDLNLF PSLSDMMMSG NDMHGFVMHN KWVAAATGGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-15153214263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
4g91_A6e-16153214264HAPB protein
4g92_A6e-16153214264HAPB protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023760897.10.0nuclear transcription factor Y subunit A-2-like
TrEMBLA0A2J6LK360.0A0A2J6LK36_LACSA; Uncharacterized protein
STRINGVIT_08s0032g01190.t013e-93(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05690.12e-47nuclear factor Y, subunit A2