PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa002343
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family MIKC_MADS
Protein Properties Length: 247aa    MW: 28367.5 Da    PI: 10.0241
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-43190PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.41.1e-29959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krienk+ rqvtfskRr+g+lKKA+E+SvLCda+va+i+fs++gkl+eys+
  Lsa002343  9 KRIENKISRQVTFSKRRTGLLKKAHEISVLCDADVALIVFSTKGKLFEYST 59
               79***********************************************96 PP

2K-box100.72e-33821748100
      K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                + e++++ s++ e++kL+++ie L++++Rh++GedLe+L+l+eLq++eqqLe++lk+iR++Kn++++e+i+el kke++lqe+n+aL+kkl+e
  Lsa002343  82 APETETQGSWTLESSKLRAKIEVLEKNIRHYVGEDLEPLNLRELQSVEQQLETALKRIRTRKNQVMHESISELHKKERALQEQNNALSKKLKE 174
                456777899*********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.6E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.679161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-33291IPR002100Transcription factor, MADS-box
CDDcd002658.60E-41276No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-30323IPR002100Transcription factor, MADS-box
PfamPF003193.1E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-303859IPR002100Transcription factor, MADS-box
PfamPF014862.0E-2885172IPR002487Transcription factor, K-box
PROSITE profilePS5129716.68688178IPR002487Transcription factor, K-box
Gene3DG3DSA:1.20.120.1602.3E-4121205IPR008207Signal transduction histidine kinase, phosphotransfer (Hpt) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004871Molecular Functionsignal transducer activity
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MGRGRVQLKR IENKISRQVT FSKRRTGLLK KAHEISVLCD ADVALIVFST KGKLFEYSTH  60
SSMEAILERY ERYSYAEKLL TAPETETQGS WTLESSKLRA KIEVLEKNIR HYVGEDLEPL  120
NLRELQSVEQ QLETALKRIR TRKNQVMHES ISELHKKERA LQEQNNALSK KLKENDKNND  180
QQNVALMLPQ THQPPPPPPP PPPPQPPHLR PLTIGSGSFH GAVVIREDES AQAHTMMPPW  240
LLRHMNQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A3e-21174173MEF2 CHIMERA
6byy_B3e-21174173MEF2 CHIMERA
6byy_C3e-21174173MEF2 CHIMERA
6byy_D3e-21174173MEF2 CHIMERA
6bz1_A3e-21174173MEF2 CHIMERA
6bz1_B3e-21174173MEF2 CHIMERA
6bz1_C3e-21174173MEF2 CHIMERA
6bz1_D3e-21174173MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023729203.10.0truncated transcription factor CAULIFLOWER A-like
SwissprotD7SMN61e-98FULL_VITVI; Agamous-like MADS-box protein FUL-L
TrEMBLA0A2U1LZQ21e-141A0A2U1LZQ2_ARTAN; Floral-meristem protein
TrEMBLU3TDN01e-141U3TDN0_9ASTR; Floral-meristem identity protein
STRINGXP_004304203.11e-103(Fragaria vesca)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.12e-91MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]