PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa001665
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family GRF
Protein Properties Length: 303aa    MW: 33771.9 Da    PI: 7.5891
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58681672PU_refUnigeneView CDS
PUT-187a-Lactuca_sativa-42948PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.45.3e-2389133145
        WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                d+epgrCrRtDGKkWRCs+++   +k+CErH++rgr+rsrk++e+
  Lsa001665  89 DPEPGRCRRTDGKKWRCSKEAFHESKYCERHMNRGRNRSRKPVES 133
                79****************************************986 PP

2QLQ64.33e-222560237
        QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
               +FTa Q+q+L++Q+l+yKyL+a++PvP++L+++i++
  Lsa001665 25 PFTAVQWQELEHQALIYKYLVAGVPVPSDLVLPIRR 60
               9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.2E-122460IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.912560IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.5E-162559IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.21389133IPR014977WRC domain
PfamPF088795.9E-2090132IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
XHARRFSGSK SVAVSGGGGD WYRAPFTAVQ WQELEHQALI YKYLVAGVPV PSDLVLPIRR  60
SFEALSAKLL HHPALGYTNL SLYYGKKFDP EPGRCRRTDG KKWRCSKEAF HESKYCERHM  120
NRGRNRSRKP VESQSTAKGG SYQNVISTAT AKSLNPITTN SGTGSYNFGN NGSKLQLDTI  180
PYGINTKDLR YSQEQTVTVN VDNQNYALKL CGDSNDNDLD NSWSSQVVTD SSHNDSYSNT  240
FEPIPMPMID DDANNSISMS SSSSSSKQQS QQHFCFFGGE IDQVNHDEQD NSMLPIPWSN  300
LNA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023735139.10.0growth-regulating factor 4-like
TrEMBLA0A2J6KCP00.0A0A2J6KCP0_LACSA; Uncharacterized protein
STRINGSolyc08g075950.1.17e-79(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-47growth-regulating factor 5