PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa001109
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family G2-like
Protein Properties Length: 257aa    MW: 29061.3 Da    PI: 7.5809
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58679622PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.4e-321972255
    G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
               prlrWtp+LH++Fv+a+++LGG+ekAtPk +l++m+v gLt++hvkSHLQ+YR+
  Lsa001109 19 PRLRWTPDLHRSFVHAIDRLGGPEKATPKLVLHMMDVRGLTISHVKSHLQMYRS 72
               8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.5021575IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-301574IPR009057Homeodomain-like
SuperFamilySSF466891.11E-141773IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-231973IPR006447Myb domain, plants
PfamPF002492.4E-72071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MGSCGRNGAV RQYIRSKVPR LRWTPDLHRS FVHAIDRLGG PEKATPKLVL HMMDVRGLTI  60
SHVKSHLQMY RSMKSDGNRQ EDEDPHSIGS HNRRQSLDDH HDGCLDHDHH DHTIHPHSFI  120
YTLPSKRKEQ EESIGNLRWQ QQPPISFSSF QHFILHPSFT HVNPLHPESD FLKIPKQGDG  180
NSGSFKRRKM ESSTSTEDED GYGLLLTLSL PHPSTQRSSN ASSTSETSEV YSKPDVNDGS  240
LNKCSVNLDL SIAFCGN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002281928.14e-68PREDICTED: myb family transcription factor APL isoform X2
TrEMBLA0A103XCP51e-120A0A103XCP5_CYNCS; Homeodomain-like protein
STRINGVIT_01s0137g00050.t011e-67(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.16e-34G2-like family protein