PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR12G13750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family GRAS
Protein Properties Length: 651aa    MW: 71200.2 Da    PI: 4.9382
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR12G13750.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS285.31.7e-873416411302
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l++lL++cA+av+++d + a++lL++++++a p+gd++qRla++f+e+L+arla+++s + ++l +++ts    ++ l+a++l+  +  + k+s
  LPERR12G13750.1 341 LRTLLIHCAQAVATDDRRSATELLKQIKQHAKPTGDATQRLAHCFAEGLQARLAGTGSLVHQSLMAKRTS---AVDILQAYQLYMAAICFKKVS 431
                      6789***************************************************999999999998888...9******************** PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      ++  Nq+I++a  g++++Hi+D++i++G+QWp++l+ +++R++gpp++RiTg++ p++g   +e++ etg+rL+k+A+e++vpf++n ++a ++
  LPERR12G13750.1 432 FMFSNQTIYNASLGKKKIHIVDYGIQYGFQWPCFLRRISQREGGPPEVRITGIDLPQPGfrPTERIDETGRRLSKYAQEFNVPFKYNSIAAAKM 525
                      **********************************************************9******************************999** PP

             GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                      e+++ e+L+++p+E+l Vn++ + ++l+desv ++s+rd vL+ +++++P+v++++  + + +++ F++rf eal yysalfd l+a+ prese
  LPERR12G13750.1 526 ESIRKEDLNIDPDEVLFVNCQCHFKNLMDESVVIDSPRDIVLSNIRKMQPHVFIHSIVNGSFSAPFFVTRFREALFYYSALFDVLDATTPRESE 619
                      ********************************************************************************************** PP

             GRAS 281 erikvErellgreivnvvaceg 302
                      +r  +E+ ++gr++ nv+ac +
  LPERR12G13750.1 620 QRLLIEQNIFGRAALNVIACYE 641
                      ********************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098554.935315651IPR005202Transcription factor GRAS
PfamPF035145.8E-85341641IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 651 aa     Download sequence    Send to blast
MGSSSTAADS FPIAGDDVTG GGIGIHDAAD DFFYLSDLAP ASPSSYLNLP PSPHPPGDHQ  60
GGGGGGGDSS SSAAAAAGPE DLVLPFISRM LMEEDIDDKF FYDYPDHPAL LQAQQPFLEI  120
LSDPSSTSIS DDLLRLSSPT SSDTSAAAVN SYPSAAPVEL DPAEFFANSD LMSTAFLKGM  180
EEANKFLPSE DKLTIIDLEA SSENYLKGVE EARRFLPSDD RLNLVGFNGV TVKKEEAVDV  240
VTVAAAAGRG RKNRYDDEEL EMEGGRSSKQ TAVQGDDVAA RAMFDQVMMP SHENCTEMME  300
KLRIAMREEA AKNEASNGGG KGGSNGKTRG ARRGGKDVVD LRTLLIHCAQ AVATDDRRSA  360
TELLKQIKQH AKPTGDATQR LAHCFAEGLQ ARLAGTGSLV HQSLMAKRTS AVDILQAYQL  420
YMAAICFKKV SFMFSNQTIY NASLGKKKIH IVDYGIQYGF QWPCFLRRIS QREGGPPEVR  480
ITGIDLPQPG FRPTERIDET GRRLSKYAQE FNVPFKYNSI AAAKMESIRK EDLNIDPDEV  540
LFVNCQCHFK NLMDESVVID SPRDIVLSNI RKMQPHVFIH SIVNGSFSAP FFVTRFREAL  600
FYYSALFDVL DATTPRESEQ RLLIEQNIFG RAALNVIACY EGDGYPKLLK L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-353456428301GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126200.0CP012620.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 12 sequence.
GenBankAP0149680.0AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAL8448780.0AL844878.4 Oryza sativa chromosome 12, . BAC OSJNBb0036A19 of library OSJNBb from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAL7724250.0AL772425.7 Oryza sativa chromosome 12, . BAC OJ1396_C02 of library Monsanto from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAK1219430.0AK121943.1 Oryza sativa Japonica Group cDNA clone:J033107F03, full insert sequence.
GenBankAK1115220.0AK111522.1 Oryza sativa Japonica Group cDNA clone:J013002M11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620149.10.0PREDICTED: scarecrow-like protein 34
TrEMBLA0A0D9Y0N80.0A0A0D9Y0N8_9ORYZ; Uncharacterized protein
STRINGLOC_Os12g38490.10.0(Oryza sativa Japonica Group)
STRINGORGLA12G0145700.10.0(Oryza glaberrima)
STRINGORGLA12G0207400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-122GRAS family protein