PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR12G09930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family ARF
Protein Properties Length: 834aa    MW: 91754.5 Da    PI: 6.478
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR12G09930.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.46.4e-24142243199
                      EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                      f+k+lt sd++++g +++ +++a+e+       +  ++ +++l+ +d++g +W++++i+r++++r++l++GW+ Fv+a++L +gD ++F   + 
  LPERR12G09930.1 142 FCKTLTASDTSTHGGFSVLRRHADEClppldmsQ--HPPTQELVAKDLHGVEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFL--RG 231
                      99*****************************544..455569************************************************..44 PP

                      SEE..EEEEE-S CS
               B3  88 sefelvvkvfrk 99 
                      +++el+v+v+r+
  LPERR12G09930.1 232 ENGELRVGVRRA 243
                      9999*****996 PP

2Auxin_resp111.96.4e-37268350183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      a+ha++t+++F+v+Y+Pr+s+seFvv+++ +e++lk++ s+GmRfkm fe+e+++e+r++Gt+vg+ d+dp+ W +SkWrsLk
  LPERR12G09930.1 268 AWHAVNTGTMFTVYYKPRTSPSEFVVPRDLYEESLKRNHSIGMRFKMTFEGEEAAEQRFTGTIVGIGDSDPSGWADSKWRSLK 350
                      89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.85E-41135271IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.9E-42136257IPR015300DNA-binding pseudobarrel domain
CDDcd100176.96E-22140242No hitNo description
SMARTSM010199.8E-24142244IPR003340B3 DNA binding domain
PfamPF023628.2E-22142243IPR003340B3 DNA binding domain
PROSITE profilePS5086311.899142244IPR003340B3 DNA binding domain
PfamPF065074.1E-34268350IPR010525Auxin response factor
PROSITE profilePS5174523.528707790IPR000270PB1 domain
SuperFamilySSF542772.5E-12709782No hitNo description
PfamPF023094.2E-7749791IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 834 aa     Download sequence    Send to blast
MAAAATAVDG LAAAGEGGGG GVDGLFVELW RACAGPLVNV PAVGERVFYL PQGHIEQVEA  60
STNQVAEQQG TPLYNLPWKI PCKVMNVELK AEPDTDEVYA QLTLLPEKQQ DGNGNANASK  120
DQGEEEEVVP PSATERPRVH SFCKTLTASD TSTHGGFSVL RRHADECLPP LDMSQHPPTQ  180
ELVAKDLHGV EWRFRHIFRG QPRRHLLQSG WSVFVSAKRL VAGDAFIFLR GENGELRVGV  240
RRAMRQQANI PSSVISSHSM HLGVLATAWH AVNTGTMFTV YYKPRTSPSE FVVPRDLYEE  300
SLKRNHSIGM RFKMTFEGEE AAEQRFTGTI VGIGDSDPSG WADSKWRSLK VRWDETASVP  360
RPDRVSPWQI EPANSPSPVN PLPAPRTKRA RPNVISSSSD LSAVNKEVAS KVIANSQQNV  420
LPRVFHSQEN TNLRSRFGDS NELNTSQKLT MWSSGSNQQK NNAAVQRELG SQGWMSIRRP  480
DGSTELLSGF QPLKDTRNPL SSFPGQISGN RSNTWNTINV HYPDQNVNHN MFPGTWPFMP  540
QDTGFGVNQQ SYLMAPDTTL PQRSLNAKFG GNGAFTSLRA HGIDQRSSGW LGHIEPSSHI  600
DDASSSLIKP QPLVIDHNVQ KTKGSSCMLF GISLDSPAKP EQLISPPSVA FDGKPQQDAL  660
EEDECSDPSK SVKPLDGAQH DSAMEKHQSC PEGARNIQSK QQNGSSRSCK KVHKQGIALG  720
RSIDLTKFTC YDELIAELDR MFDFNGELNS CKNWMVVYTD NEGDMMLVGD DPWNEFCNMV  780
HKIFIYTREE VQKMNPGALN SRSEDSRSTS VERGLAGEGV QGGISTPSLN SENC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-170133777359Auxin response factor 1
4ldw_A1e-170133777359Auxin response factor 1
4ldw_B1e-170133777359Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0670610.0AK067061.1 Oryza sativa Japonica Group cDNA clone:J013091D19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620412.10.0PREDICTED: auxin response factor 24 isoform X1
RefseqXP_015620411.10.0PREDICTED: auxin response factor 24 isoform X1
SwissprotQ2QQX60.0ARFX_ORYSJ; Auxin response factor 24
TrEMBLA0A0D9XZA50.0A0A0D9XZA5_9ORYZ; Auxin response factor
STRINGLOC_Os12g29520.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP117836111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2