PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR12G05220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MIKC_MADS
Protein Properties Length: 187aa    MW: 21495 Da    PI: 10.3461
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR12G05220.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.13.6e-261058250
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     rien   rqvtf+kRr gilKKA ELSvLCda+v viifss+gkl+e +
  LPERR12G05220.1 10 RIENPVHRQVTFCKRRGGILKKARELSVLCDADVGVIIFSSQGKLHELA 58
                     8*********************************************965 PP

2K-box35.34.8e-131071822298
            K-box  22 akLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                      + Lk+    + r+ R   G + ++++l  L++Le+ Le    +iR+kK++++ ++i+ l++ke  ++ +n++L++k 
  LPERR12G05220.1 107 SYLKNFEVIMNRS-RSAYGGGAGEMTLDKLHELEKGLELWSYQIRTKKMQMMQQEIQFLRNKEGIMKAANEMLQEKA 182
                      4555554555555.************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554553.92E-28175IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.394161IPR002100Transcription factor, MADS-box
SMARTSM004326.6E-36160IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002652.70E-36373No hitNo description
PRINTSPR004041.2E-26323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-231056IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS512979.95485187IPR002487Transcription factor, K-box
PfamPF014864.4E-14111181IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MVRGKVQMRR IENPVHRQVT FCKRRGGILK KARELSVLCD ADVGVIIFSS QGKLHELATN  60
GNMHNLVQRY QSNVEGNQME RGALQRQVTE GVFLLREEIG LLQRGLSYLK NFEVIMNRSR  120
SAYGGGAGEM TLDKLHELEK GLELWSYQIR TKKMQMMQQE IQFLRNKEGI MKAANEMLQE  180
KASVQLQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR12G05220.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1777001e-111AY177700.1 Oryza sativa (japonica cultivar-group) transcription factor MADS33 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025878024.11e-104MADS-box transcription factor 33 isoform X4
SwissprotQ2QW551e-103MAD33_ORYSJ; MADS-box transcription factor 33
TrEMBLA0A0D9XXS41e-133A0A0D9XXS4_9ORYZ; Uncharacterized protein
STRINGLPERR12G05220.11e-134(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.13e-53AGAMOUS-like 12