PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR12G00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family LBD
Protein Properties Length: 146aa    MW: 16199.6 Da    PI: 7.4683
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR12G00030.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.52.3e-4381071100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +Ca+Ck+lrr+C+++Cv+apyfpae++++fa+vh++FGasnv+k+l+++p  +r da+sslvyeA+ar+rdPvyG+v+ i+ lqqq+++l+ +l
  LPERR12G00030.1   8 PCASCKLLRRRCTAECVFAPYFPAEEAQRFAMVHRVFGASNVSKMLQEVPAAQRADAVSSLVYEANARVRDPVYGCVAAISFLQQQVSHLQMQL 101
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      al+++e
  LPERR12G00030.1 102 ALAHAE 107
                      *99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.2467108IPR004883Lateral organ boundaries, LOB
PfamPF031954.8E-438105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MAGSGGTPCA SCKLLRRRCT AECVFAPYFP AEEAQRFAMV HRVFGASNVS KMLQEVPAAQ  60
RADAVSSLVY EANARVRDPV YGCVAAISFL QQQVSHLQMQ LALAHAETSA LQLQLQDERQ  120
QHILVQNAHH QLMLQEACLK QESMWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBX0004971e-131BX000497.1 Oryza sativa chromosome 11, . BAC OSJNBa0010K05 of library OSJNBa from chromosome 11 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankBX0004941e-131BX000494.2 Oryza sativa chromosome 12, . BAC OSJNBa0052H10 of library OSJNBa from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAP0149681e-131AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAP0149671e-131AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBankAK2417611e-131AK241761.1 Oryza sativa Japonica Group cDNA, clone: J065205C18, full insert sequence.
GenBankAK1092111e-131AK109211.1 Oryza sativa Japonica Group cDNA clone:002-156-D02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618083.11e-75PREDICTED: LOB domain-containing protein 12
RefseqXP_015618082.11e-75PREDICTED: LOB domain-containing protein 12
RefseqXP_015618081.11e-75PREDICTED: LOB domain-containing protein 12
RefseqXP_015617628.11e-75PREDICTED: LOB domain-containing protein 12
RefseqXP_015697528.12e-75PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW32e-60LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0D9XVT71e-104A0A0D9XVT7_9ORYZ; Uncharacterized protein
STRINGBGIOSGA034653-PA4e-75(Oryza sativa Indica Group)
STRINGLOC_Os11g01550.14e-75(Oryza sativa Japonica Group)
STRINGLOC_Os12g01550.14e-75(Oryza sativa Japonica Group)
STRINGOB11G10200.15e-75(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.19e-62LBD family protein