PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR11G20420.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family GRAS
Protein Properties Length: 681aa    MW: 75958.4 Da    PI: 4.8508
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR11G20420.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS341.21.7e-1042976741373
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l++lL++cA+av++gd ++a+ lL+++++++sp+gd++qRla +f+e+L+arla+++se+yk+l +++ts    ++ l+a+kl+  +  + k+ 
  LPERR11G20420.2 297 LRTLLIHCAQAVATGDRRNATDLLSQIKHHSSPRGDATQRLACCFAEGLEARLAGTGSEVYKSLMSKRTS---AVDFLKAYKLYTAAICVKKVN 387
                      6789************************************************************999998...9******************** PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      ++  N++I +a++g+ ++Hi+D+++ +G+QWp L++ La+R++g+p++RiTg++ p++g   ++++eetg+rLa+ A+e+gvpf+f++ +a ++
  LPERR11G20420.2 388 FIFFNNTIHDAAAGKPKLHIVDYGVHYGFQWPGLFKLLADRDGGAPEVRITGIDLPQPGfrPAHQIEETGRRLANCAREFGVPFKFRA-IAAKW 480
                      **********************************************************9*9***************************.799** PP

             GRAS 187 edleleeLrvkp..gEalaVnlvlqlhrlldesvsles.....erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdslea 273
                      e+++ e+L+++   +E+l+Vn+ + l +l desv   +     +rd vL+ +++++Pkv+v +  +  ++++ F++rf eal yysa fd+l+a
  LPERR11G20420.2 481 ETIRAEHLDIDAddDEVLVVNCLHGLNNLQDESVFAVDddkpsPRDVVLRNIRDMRPKVFVECVVNGAYGAPFFVTRFREALFYYSAQFDMLDA 574
                      ********999999****************99986554455669************************************************** PP

             GRAS 274 klpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpL 367
                      ++pr+s+er  +Er ++gr + nv+acega+r+ r et+++W  r ++aG++++pl+ + ++ ++  +++++ + + ++ ++ +l++gWk+r L
  LPERR11G20420.2 575 TIPRDSDERLLIERDIIGRCALNVIACEGADRVDRPETYKQWAVRHHRAGLTQLPLDAHLVQVVRDKVKNYYHRDFVIDVDQRWLLQGWKGRIL 668
                      ************************************************************************999******************* PP

             GRAS 368 vsvSaW 373
                      +++S W
  LPERR11G20420.2 669 YAMSTW 674
                      ****** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.362271655IPR005202Transcription factor GRAS
PfamPF035146.0E-102297674IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
MAAAAAQEEQ LVVEPFSPSI FLDLPPTPNE EDQDLLLPYI SRMLMEEDID DKFFYQFPDH  60
PALLNAQQPY AQILEDTTSP SDDTTTNNTS SSSGDDSTAN ANAGDWPYDP IELSQLLQSP  120
PHPDTVTLAD DDDVIAAFRD ATTQQPPEDE AAAGENKNNM EMLLNKAFQK GMEEATKFLP  180
TNNTLLAGFN PDPVLDDTAA FILGNSRGRK NRPHDDLEAE TGRSSKLMVP PDQDDTAAAR  240
QMFDEIMLNG YEVFLKGMHD LRIAMDSDAE KKARSNAPAA GRRRSKTSSP SAAVVDLRTL  300
LIHCAQAVAT GDRRNATDLL SQIKHHSSPR GDATQRLACC FAEGLEARLA GTGSEVYKSL  360
MSKRTSAVDF LKAYKLYTAA ICVKKVNFIF FNNTIHDAAA GKPKLHIVDY GVHYGFQWPG  420
LFKLLADRDG GAPEVRITGI DLPQPGFRPA HQIEETGRRL ANCAREFGVP FKFRAIAAKW  480
ETIRAEHLDI DADDDEVLVV NCLHGLNNLQ DESVFAVDDD KPSPRDVVLR NIRDMRPKVF  540
VECVVNGAYG APFFVTRFRE ALFYYSAQFD MLDATIPRDS DERLLIERDI IGRCALNVIA  600
CEGADRVDRP ETYKQWAVRH HRAGLTQLPL DAHLVQVVRD KVKNYYHRDF VIDVDQRWLL  660
QGWKGRILYA MSTWVRDGGG P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-353016748374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006663689.10.0PREDICTED: scarecrow-like protein 34
TrEMBLA0A0D9XVR40.0A0A0D9XVR4_9ORYZ; Uncharacterized protein
STRINGBGIOSGA035741-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-157GRAS family protein