PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR11G18320.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family M-type_MADS
Protein Properties Length: 291aa    MW: 32387.2 Da    PI: 6.7463
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR11G18320.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF64.11.5e-201053245
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                     + en+s r+vt+skRr gilKKA+ELS+LCd+   +++fs+t+k
  LPERR11G18320.1 10 KLENSSGRHVTYSKRRSGILKKAKELSILCDIPLILLMFSPTDK 53
                     679**************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.3E-27160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.366153IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-24295IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-15323IPR002100Transcription factor, MADS-box
PfamPF003192.2E-171154IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-152338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-153859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGRVKLKIKK LENSSGRHVT YSKRRSGILK KAKELSILCD IPLILLMFSP TDKPTICVGD  60
HSSIEDVITK YAQQTPQERA KRKLESLEAL KKTFKKLDHD FQNDMQLPLG LTGDPSTSSW  120
FHASSGAEGQ QPIMLPEDPS LLHQRDIGCS ASTSLQSYPG YFSMSKQSTD NAGGEHHHQH  180
HNLAAAAVQQ PEFSQADCLT SLQLGAQFPY QSTFDHTSLL NDRLFIRQDM DQLHDHNAAA  240
AAAAPMDFGC QYDLPRPGDE ASFQNWASAA CGANMYDHQQ QQQQPAQRSD Y
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR11G18320.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006663090.17e-88PREDICTED: agamous-like MADS-box protein AGL65 isoform X1
RefseqXP_015697841.16e-88PREDICTED: agamous-like MADS-box protein AGL65 isoform X2
RefseqXP_015697842.16e-88PREDICTED: agamous-like MADS-box protein AGL65 isoform X3
TrEMBLA0A0D9XUZ00.0A0A0D9XUZ0_9ORYZ; Uncharacterized protein
STRINGLPERR11G18320.10.0(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.12e-46AGAMOUS-like 65