PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR11G11950.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family ARF
Protein Properties Length: 797aa    MW: 88651.7 Da    PI: 6.9456
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR11G11950.4genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.99.4e-2493194199
                      EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                      f+k+lt sd++++g +++ +++a+e+      + + + +++l+ +d++g +W++++i+r++++r++l++GW+ Fv+a++L +gD ++F   + +
  LPERR11G11950.4  93 FCKTLTASDTSTHGGFSVLRRHADEClppldmSRQ-PPTQELVAKDLHGVEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFL--RGE 183
                      99*****************************7333.34459************************************************..449 PP

                      EE..EEEEE-S CS
               B3  89 efelvvkvfrk 99 
                      ++el+v+v+r+
  LPERR11G11950.4 184 NGELRVGVRRA 194
                      999*****996 PP

2Auxin_resp116.42.4e-38219301183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      a+ha++t+++F+v+Y+Pr+s++eFvv++++++++lk+++s+GmRfkm+fe+e+++e+r++Gt+vg+ d+dp  Wp+SkWrsLk
  LPERR11G11950.4 219 AWHAVNTGTMFTVYYKPRTSPAEFVVPYDRYMESLKRNYSIGMRFKMRFEGEEAPEQRFTGTIVGMGDSDPAGWPESKWRSLK 301
                      89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.4E-4285208IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.85E-4188222IPR015300DNA-binding pseudobarrel domain
CDDcd100176.36E-2291193No hitNo description
SMARTSM010199.9E-2493195IPR003340B3 DNA binding domain
PROSITE profilePS5086311.89993195IPR003340B3 DNA binding domain
PfamPF023621.2E-2193194IPR003340B3 DNA binding domain
PfamPF065071.1E-35219301IPR010525Auxin response factor
PfamPF023096.0E-10666753IPR033389AUX/IAA domain
PROSITE profilePS5174520.244669753IPR000270PB1 domain
SuperFamilySSF542773.83E-11672745No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 797 aa     Download sequence    Send to blast
MVTAEVEAAA AAAAGVEAST NQVSEQRMQL YNLPWKIPCE VMNVELKAEP DTDEVYAQLT  60
LLPESKQQEE NGCTEEEAPT APATHVRPRV HSFCKTLTAS DTSTHGGFSV LRRHADECLP  120
PLDMSRQPPT QELVAKDLHG VEWRFRHIFR GQPRRHLLQS GWSVFVSAKR LVAGDAFIFL  180
RGENGELRVG VRRAMRQQTN VPSSVISSHS MHLGVLATAW HAVNTGTMFT VYYKPRTSPA  240
EFVVPYDRYM ESLKRNYSIG MRFKMRFEGE EAPEQRFTGT IVGMGDSDPA GWPESKWRSL  300
KVRWDEASSI PRPERVSPWQ IEPAVNPPPI NPLPVPRTKR LRPNVTASPP DPSAVAKEAA  360
PKVTVESEPN GMQRAFQTQE NAAPKGSFGN SSELDTAQKS VMRSSGFDRE KNNISTQRKL  420
GSDGWMQMNR PENYSEMLSG FQPPKDVQTP QGFCSLPDQI TPGHSNFWHT VNAQYQDQQG  480
NHNMFPSSWS FMPPNTGLGL NKQNYSMIQE VGGLSQRAMN TKFGNGVYAA QPGRGIEQYS  540
GAWFGHMIPS SHMDDTQPRL IKPKPLVVAH GDVQKAKGAS CKLFGIHLDS PVKSELLKSP  600
SSVVYDGTPQ TPGVEWRRQD VNEVEKCSDP SKTLKSLDAP QADSVPEKPL SCQQASRNMP  660
CKSQGGSTRS CKKVHKQGIA LGRSVDLTKF DGYEGLIAEL DDMFDFTGEL KGPNKEWMVV  720
YTDNEGDMML VGDDPWIEFC DMVHKIFIYT REEVQRMNPG TLNSRSEDSH ANSVERGSVA  780
REMRGCVSTS SLNSENC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1511632352354Auxin response factor 1
4ldw_A1e-1511632352354Auxin response factor 1
4ldw_B1e-1511632352354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ3063060.0AJ306306.1 Oryza sativa subsp. japonica mRNA for auxin response factor 1 (arf1 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015697998.10.0PREDICTED: auxin response factor 23
SwissprotA2ZET60.0ARFW_ORYSI; Auxin response factor 23
TrEMBLA0A0D9XSI10.0A0A0D9XSI1_9ORYZ; Auxin response factor
STRINGOB11G21910.10.0(Oryza brachyantha)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2