PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR11G11950.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family ARF
Protein Properties Length: 854aa    MW: 94254.9 Da    PI: 6.6291
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR11G11950.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.81e-23150251199
                      EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                      f+k+lt sd++++g +++ +++a+e+      + + + +++l+ +d++g +W++++i+r++++r++l++GW+ Fv+a++L +gD ++F   + +
  LPERR11G11950.3 150 FCKTLTASDTSTHGGFSVLRRHADEClppldmSRQ-PPTQELVAKDLHGVEWRFRHIFRGQPRRHLLQSGWSVFVSAKRLVAGDAFIFL--RGE 240
                      99*****************************7333.34459************************************************..449 PP

                      EE..EEEEE-S CS
               B3  89 efelvvkvfrk 99 
                      ++el+v+v+r+
  LPERR11G11950.3 241 NGELRVGVRRA 251
                      999*****996 PP

2Auxin_resp116.32.7e-38276358183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      a+ha++t+++F+v+Y+Pr+s++eFvv++++++++lk+++s+GmRfkm+fe+e+++e+r++Gt+vg+ d+dp  Wp+SkWrsLk
  LPERR11G11950.3 276 AWHAVNTGTMFTVYYKPRTSPAEFVVPYDRYMESLKRNYSIGMRFKMRFEGEEAPEQRFTGTIVGMGDSDPAGWPESKWRSLK 358
                      89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.7E-42142265IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-41145279IPR015300DNA-binding pseudobarrel domain
CDDcd100177.29E-22148250No hitNo description
PfamPF023621.4E-21150251IPR003340B3 DNA binding domain
SMARTSM010199.9E-24150252IPR003340B3 DNA binding domain
PROSITE profilePS5086311.899150252IPR003340B3 DNA binding domain
PfamPF065071.2E-35276358IPR010525Auxin response factor
PROSITE profilePS5174520.244726810IPR000270PB1 domain
SuperFamilySSF542775.62E-11729802No hitNo description
PfamPF023092.1E-6772810IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 854 aa     Download sequence    Send to blast
MVTAEVEAAA AAAAGVGGGE GDAAMARGGG GGGGGGEDAL FTELWSACAG PLVTVPRVGE  60
KVFYFPQGHI EQVEASTNQV SEQRMQLYNL PWKIPCEVMN VELKAEPDTD EVYAQLTLLP  120
ESKQQEENGC TEEEAPTAPA THVRPRVHSF CKTLTASDTS THGGFSVLRR HADECLPPLD  180
MSRQPPTQEL VAKDLHGVEW RFRHIFRGQP RRHLLQSGWS VFVSAKRLVA GDAFIFLRGE  240
NGELRVGVRR AMRQQTNVPS SVISSHSMHL GVLATAWHAV NTGTMFTVYY KPRTSPAEFV  300
VPYDRYMESL KRNYSIGMRF KMRFEGEEAP EQRFTGTIVG MGDSDPAGWP ESKWRSLKVR  360
WDEASSIPRP ERVSPWQIEP AVNPPPINPL PVPRTKRLRP NVTASPPDPS AVAKEAAPKV  420
TVESEPNGMQ RAFQTQENAA PKGSFGNSSE LDTAQKSVMR SSGFDREKNN ISTQRKLGSD  480
GWMQMNRPEN YSEMLSGFQP PKDVQTPQGF CSLPDQITPG HSNFWHTVNA QYQDQQGNHN  540
MFPSSWSFMP PNTGLGLNKQ NYSMIQEVGG LSQRAMNTKF GNGVYAAQPG RGIEQYSGAW  600
FGHMIPSSHM DDTQPRLIKP KPLVVAHGDV QKAKGASCKL FGIHLDSPVK SELLKSPSSV  660
VYDGTPQTPG VEWRRQDVNE VEKCSDPSKT LKSLDAPQAD SVPEKPLSCQ QASRNMPCKS  720
QGGSTRSCKK VHKQGIALGR SVDLTKFDGY EGLIAELDDM FDFTGELKGP NKEWMVVYTD  780
NEGDMMLVGD DPWIEFCDMV HKIFIYTREE VQRMNPGTLN SRSEDSHANS VERGSVAREM  840
RGCVSTSSLN SENC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-175233802354Auxin response factor 1
4ldw_A1e-175233802354Auxin response factor 1
4ldw_B1e-175233802354Auxin response factor 1
4ldx_A1e-175233802354Auxin response factor 1
4ldx_B1e-175233802354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ3063060.0AJ306306.1 Oryza sativa subsp. japonica mRNA for auxin response factor 1 (arf1 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015697998.10.0PREDICTED: auxin response factor 23
SwissprotA2ZET60.0ARFW_ORYSI; Auxin response factor 23
TrEMBLA0A0D9XSI00.0A0A0D9XSI0_9ORYZ; Auxin response factor
STRINGOB11G21910.10.0(Oryza brachyantha)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2