PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR11G00440.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family LBD
Protein Properties Length: 325aa    MW: 35464.7 Da    PI: 8.4337
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR11G00440.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601376.8e-431932921100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +Ca+Ck+lrr+C+++Cv+apyfpae++++fa+vh++FGasnv+k+l+++p+ +r da+sslvyeA+ar+rdPvyG+v+ i+ lqqq+++l+ +l
  LPERR11G00440.2 193 PCASCKLLRRRCTAECVFAPYFPAEEAQRFAMVHRVFGASNVSKMLHDVPPPQRADAVSSLVYEANARVRDPVYGCVAAISFLQQQVSHLQMQL 286
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      al+++e
  LPERR11G00440.2 287 ALAHAE 292
                      *99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.52192293IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-42193290IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MAMAAAGDGD DHLLSLFASS LSHRRHAQPT FFLLLCKPLA FCFLQPLHSS APHRFGDTEL  60
RLLDAALSAG ADVSALLHTR SSARQLLRQS AAQAFSVPAP DLCTRLSIAD FFARAFALTG  120
DVEKDKITDI SRLQNLAKSL SAMCSVQTQS AEYMKRKASG VDEKGNLHSV KSKLPGSSIQ  180
FSREASMAGS GTPCASCKLL RRRCTAECVF APYFPAEEAQ RFAMVHRVFG ASNVSKMLHD  240
VPPPQRADAV SSLVYEANAR VRDPVYGCVA AISFLQQQVS HLQMQLALAH AETSALQLQQ  300
HILVQNAHHQ LMLQEACLKQ ESMWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBX0004971e-137BX000497.1 Oryza sativa chromosome 11, . BAC OSJNBa0010K05 of library OSJNBa from chromosome 11 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankBX0004941e-137BX000494.2 Oryza sativa chromosome 12, . BAC OSJNBa0052H10 of library OSJNBa from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAP0149681e-137AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankAP0149671e-137AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
GenBankAK2417611e-137AK241761.1 Oryza sativa Japonica Group cDNA, clone: J065205C18, full insert sequence.
GenBankAK1092111e-137AK109211.1 Oryza sativa Japonica Group cDNA clone:002-156-D02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D9XN830.0A0A0D9XN83_9ORYZ; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.14e-56LBD family protein