PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR10G05640.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family HD-ZIP
Protein Properties Length: 282aa    MW: 30671.6 Da    PI: 4.8249
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR10G05640.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.26.6e-1948101356
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      k++++ +eq+++Le+ Fe +++++ e+++++A+ l+L  rqV vWFqNrRa++k
  LPERR10G05640.1  48 KKRRLAAEQVRALERSFEADNKLDPERKARIARDLRLHPRQVAVWFQNRRARWK 101
                      4557899**********************************************9 PP

2HD-ZIP_I/II126.31.3e-4047139193
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                      ekkrrl++eqv++LE+sFe+++kL+perK+++ar+L+l+prqvavWFqnrRAR+ktkq+E+d+++L++++dal+ e ++L++++++L++e+++
  LPERR10G05640.1  47 EKKRRLAAEQVRALERSFEADNKLDPERKARIARDLRLHPRQVAVWFQNRRARWKTKQIERDFASLRSRHDALRLECDSLRRDKDSLAAEIAS 139
                      69**************************************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.28E-1834105IPR009057Homeodomain-like
PROSITE profilePS5007116.55243103IPR001356Homeobox domain
SMARTSM003891.6E-1846107IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-1848106IPR009057Homeodomain-like
PfamPF000463.3E-1648101IPR001356Homeobox domain
CDDcd000863.31E-1648104No hitNo description
PROSITE patternPS00027078101IPR017970Homeobox, conserved site
PfamPF021834.2E-13103144IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MKRPTCRGSS MAIQDTSDQQ EENMMRYDDE EDEDMDDGGG GGGGLGEKKR RLAAEQVRAL  60
ERSFEADNKL DPERKARIAR DLRLHPRQVA VWFQNRRARW KTKQIERDFA SLRSRHDALR  120
LECDSLRRDK DSLAAEIASL RLKLLNCSKS DSAAVKLEIE NAAAGDEQPP VTTAMTIIPN  180
SNNGGGAGTD SDSSAVFNEE ASPYSGAAID HHQTPASYDT PAAAGLASFF APNSSTNSSF  240
ASMFHPSTHF EQELLAGGDL GGGFFAGEEH AGGLSWYGAE GW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
195103RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR10G05640.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0799351e-136AC079935.3 Genomic sequence for Oryza sativa (japonica cultivar-group) cultivar Nipponbare clone OSJNBa0095C06, from Chromosome 10, complete sequence.
GenBankAK2432941e-136AK243294.1 Oryza sativa Japonica Group cDNA, clone: J100053F20, full insert sequence.
GenBankAP0149661e-136AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
GenBankAY3463291e-136AY346329.1 Oryza sativa (indica cultivar-group) homeodomain leucine-zipper protein Hox8 mRNA, complete cds.
GenBankCT8376741e-136CT837674.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA120C09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015613231.11e-113homeobox-leucine zipper protein HOX8
SwissprotQ338Z71e-114HOX8_ORYSJ; Homeobox-leucine zipper protein HOX8
TrEMBLA0A0D9XJ530.0A0A0D9XJ53_9ORYZ; Uncharacterized protein
STRINGLPERR10G05640.10.0(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.22e-39homeobox protein 5
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]