PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR09G13860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 187aa    MW: 20069.7 Da    PI: 10.2929
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR09G13860.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_159.75.9e-19117170457
                      XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                      ++r +r++kNRe+A rsR+RK+a++++Le++v+ L++eNk+L+ + e+l+k v+
  LPERR09G13860.1 117 DRRKKRMIKNRESAARSRARKQARVDNLETEVELLKKENKMLRVKYEQLRKSVE 170
                      789***********************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.4E-13114181IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.909116170IPR004827Basic-leucine zipper domain
PfamPF001705.7E-17117170IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.0E-15117170No hitNo description
CDDcd147078.50E-22118168No hitNo description
SuperFamilySSF579595.44E-13118170No hitNo description
PROSITE patternPS000360121136IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000028Biological Processregulation of photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MAMEDDEDMW ANTTSPSTSP PRPAARVGAG GEGGFISTAL SLNSTCLHGL LSSSPFVSAS  60
PPCHAAGVGN GGYRNAAATP SFFSAAAASY HHGFAAVVDG AAIARQVFDH ETCGAGDRRK  120
KRMIKNRESA ARSRARKQAR VDNLETEVEL LKKENKMLRV KYEQLRKSVE VPVPVRRTLQ  180
RVLSAPF
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR09G13860.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8359082e-80CT835908.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN083I14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006660911.29e-73PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 7
TrEMBLA0A0D9XG571e-135A0A0D9XG57_9ORYZ; Uncharacterized protein
STRINGLPERR09G13860.11e-136(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97643044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.11e-10bZIP family protein