PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR09G07070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family ZF-HD
Protein Properties Length: 100aa    MW: 10947.2 Da    PI: 7.3116
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR09G07070.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer96.62e-301977160
      ZF-HD_dimer  1 kekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                     +++vrY eC++NhAa++GghavDGC+Ef+++  +egtaaalkCaACgCHR+FHRr +++e
  LPERR09G07070.1 19 CCGVRYGECRRNHAATTGGHAVDGCREFIAA-AAEGTAAALKCAACGCHRSFHRRVQVYE 77
                     5789**************************9.8889*******************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-25180IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047706.7E-292274IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.0E-232372IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.3272473IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
MMKRLVVLRR REPAVRFSCC GVRYGECRRN HAATTGGHAV DGCREFIAAA AEGTAAALKC  60
AACGCHRSFH RRVQVYEVAW DYDCADDDVD TLSSSSSSDD
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR09G07070.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0588407e-66AK058840.1 Oryza sativa Japonica Group cDNA clone:001-004-D10, full insert sequence.
GenBankAP0056367e-66AP005636.2 Oryza sativa Japonica Group genomic DNA, chromosome 9, PAC clone:P0707C02.
GenBankAP0149657e-66AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankCP0126177e-66CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
GenBankCT8305767e-66CT830576.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN030C08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025799866.11e-45mini zinc finger protein 3-like
SwissprotQ6ER221e-40MIF3_ORYSJ; Mini zinc finger protein 2
TrEMBLA0A0D9XDP97e-66A0A0D9XDP9_9ORYZ; Uncharacterized protein
STRINGLPERR09G07070.11e-66(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.13e-15mini zinc finger 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]