PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR09G06370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family G2-like
Protein Properties Length: 387aa    MW: 40107.5 Da    PI: 9.1949
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR09G06370.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.5e-32198251255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  LPERR09G06370.1 198 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 251
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15195252IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-28196252IPR009057Homeodomain-like
TIGRFAMsTIGR015579.2E-24198251IPR006447Myb domain, plants
PfamPF002496.7E-7199250IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MAAAGWVDGV DRALSLAAAG AAAGGGRSWR WSRRVPAAMA APPIRGIPIY NGPGGFPFLP  60
PSAGGLGVDA VAGHHHQKLG FYNSYHHHHP ATWPSSLGST SPSPLLAPPP PTAGDAFLST  120
TPSAAAAAAA HHHHHRMLSA SGRLNGMLSV SDTLRSYTTS AGGLAGGLHH HLHGGAPPFG  180
LASRFMPKLP AKRSMRAPRM RWTSTLHARF VHAVELLGGH ERATPKSVLE LMDVKDLTLA  240
HVKSHLQMYR TVKSTDKPAA SSGPADGGSG DEDFTGGGQA ASGGGDSMCL RGAAPFAEHG  300
RSASEGAASS VGGGDMDQSS AGNTSTTRWS NSSRDPWLSS NSCNMDAHRS NLEPCRSSSS  360
QVSNHELSSP SLEFTLGRPD WHGADHD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-16199253357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-16199253357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-16199253357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-16199253357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR09G06370.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ2687481e-136FJ268748.1 Oryza sativa Japonica Group rolled leaf 9 (RL9) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025804688.11e-159probable transcription factor RL9
SwissprotQ0J2351e-147ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A0D9XDF50.0A0A0D9XDF5_9ORYZ; Uncharacterized protein
STRINGLPERR09G06370.10.0(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.18e-45G2-like family protein