PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR09G05130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family LBD
Protein Properties Length: 306aa    MW: 32187.6 Da    PI: 5.3435
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR09G05130.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260117.57.9e-37441441101
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      aCaaCk++rrkC++dC+la+yfpa+++++f+n+h+lFG+sn++k+l+++p+e + dam++l++eA+ara dPv Ga++++++l  ql+ + +el
  LPERR09G05130.1  44 ACAACKYQRRKCNADCPLARYFPADDQRRFQNAHRLFGVSNIQKTLRRTPPELHADAMQALTFEADARAADPVGGAARLVKELDLQLKAVYSEL 137
                      7********************************************************************************************* PP

           DUF260  95 allkeel 101
                       ++++++
  LPERR09G05130.1 138 LSVHHQI 144
                      9999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.43243144IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-3344140IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MTSTTKSNSI SSSTTTTTNS SPNPPRNAAA RVGIGGGGGG QSQACAACKY QRRKCNADCP  60
LARYFPADDQ RRFQNAHRLF GVSNIQKTLR RTPPELHADA MQALTFEADA RAADPVGGAA  120
RLVKELDLQL KAVYSELLSV HHQIMLHQAA AAAAAAASEN SLPPGMIFSG AGENEEDAMV  180
DSFYVDQQVA EQYLVKDEVQ PCLYYETAAA GDEGSSHAWT SGDNGGGENS TPMVLSDQLR  240
QHYQIDQAAQ VFDVKPEVTM VGHVDGGVVV GQTETKVAAA KAGSPSSSSA EAAAAARCQL  300
ELGRSL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126172e-78CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
GenBankAP0149652e-78AP014965.1 Oryza sativa Japonica Group DNA, chromosome 9, cultivar: Nipponbare, complete sequence.
GenBankAP0056752e-78AP005675.3 Oryza sativa Japonica Group genomic DNA, chromosome 9, BAC clone:OJ1001_G09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611163.11e-84PREDICTED: LOB domain-containing protein 19, partial
TrEMBLA0A0D9XCZ20.0A0A0D9XCZ2_9ORYZ; Uncharacterized protein
STRINGBGIOSGA030605-PA1e-83(Oryza sativa Indica Group)
STRINGLOC_Os09g19950.12e-83(Oryza sativa Japonica Group)
STRINGORGLA09G0055000.12e-83(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52283461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-30LOB domain-containing protein 22