PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR09G00210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family LBD
Protein Properties Length: 87aa    MW: 9658.32 Da    PI: 9.4656
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR09G00210.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26073.34.7e-23773167
           DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAea 67
                     +Ca+Ck+l+r+C +d v+ pyfpae++++fa vh +FGa nv+k+l+++    r d++sslvyeA +
  LPERR09G00210.1  7 PCASCKLLQRQCMPDSVFMPYFPAEKAQQFARVHCVFGAINVSKMLHDVLLALRADVVSSLVYEATV 73
                     7****************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089115.198687IPR004883Lateral organ boundaries, LOB
PfamPF031957.9E-23773IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
MAGNGTPCAS CKLLQRQCMP DSVFMPYFPA EKAQQFARVH CVFGAINVSK MLHDVLLALR  60
ADVVSSLVYE ATVSPRGIPP HHRRRPH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015697528.12e-28PREDICTED: LOB domain-containing protein 12-like
SwissprotQ9SHE94e-24LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A0D9XB579e-60A0A0D9XB57_9ORYZ; Uncharacterized protein
STRINGOB11G10200.15e-28(Oryza brachyantha)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.18e-26LOB domain-containing protein 4