PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR08G17300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family LBD
Protein Properties Length: 161aa    MW: 17918.3 Da    PI: 7.0707
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR08G17300.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.25.5e-38201191100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaC++lrr+Ca+dCvlap fpa++p+++a+vh++FGasnv +ll++lp  er +a++++++eA +r++dPvyG++g+i++lq++++ ++ +l
  LPERR08G17300.1  20 RCAACRYLRRRCADDCVLAPFFPADHPHRYACVHRVFGASNVARLLQSLPMAERGNAANTMAMEAYWRVQDPVYGCTGIINRLQEEIRAVQCDL 113
                      6********************************************************************************************* PP

           DUF260  95 allkee 100
                      a+++++
  LPERR08G17300.1 114 ATTQAH 119
                      *99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.02819120IPR004883Lateral organ boundaries, LOB
PfamPF031957.0E-3820117IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MQQQQDQDDQ QPNQHPTARR CAACRYLRRR CADDCVLAPF FPADHPHRYA CVHRVFGASN  60
VARLLQSLPM AERGNAANTM AMEAYWRVQD PVYGCTGIIN RLQEEIRAVQ CDLATTQAHL  120
AIAVASHRRP PPPPLPQPPP PPQSPPPAVD PADEFLNLDG L
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649340.13e-72PREDICTED: LOB domain-containing protein 24
SwissprotP594672e-39LBD23_ARATH; LOB domain-containing protein 23
SwissprotP594682e-39LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A0D9X9S21e-114A0A0D9X9S2_9ORYZ; Uncharacterized protein
STRINGBGIOSGA029005-PA8e-73(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52823562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.11e-29LOB domain-containing protein 24