PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR08G14740.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 384aa    MW: 40272.4 Da    PI: 5.675
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR08G14740.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_151.22.8e-16272325558
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                      +r+rr++kNRe+A rsR+RK+a++ eLe +v++L+++N++L+k+ ee+ ++ ++
  LPERR08G14740.2 272 RRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKEQNMELQKKQEEMMEMQKR 325
                      79********************************************99999765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.0E-14268332IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.231270326IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.13E-11272326No hitNo description
PfamPF001703.3E-14272325IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.1E-15272324No hitNo description
CDDcd147074.29E-25272324No hitNo description
PROSITE patternPS000360275290IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MDLKDGGGAE RRGAAAAGAA PLSRQGSIYS LTFDELGGGL GKDFGSMNMD ELLRSIWTAE  60
ESQAMASASG GAAPAAGLQR QGSLTLPRTL SVKTVDEVWR DFEREVSPDA ATGGGGGEQQ  120
PGRQPTLGEM TLEEFLVRAG VVRENPAAAA AMVAAAAAAP PVAPRSIQTV NNSSIFFGNF  180
GAANDGAGAG AMGFSPVGIG DPTMGNGLMS GVAGIGGGAI TVTSVDTSVG TMDSAGKGEG  240
DLSSPMAPVP YPFESVIRGR RSGGNVEKVV ERRQRRMIKN RESAARSRAR KQAYTMELEA  300
EVQKLKEQNM ELQKKQEEMM EMQKRLFPDM QKNQVLEVVN NPYGQKKRCL RRTLTDFIVS  360
EVRELLQSAN SANSCGVGAG ASCC
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that mediates abscisic acid (ABA) signaling. Binds specifically to the ABA-responsive element (ABRE) of the EMP1 and RAB16A gene promoters. {ECO:0000269|PubMed:10611387}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR08G14740.2
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA). {ECO:0000269|PubMed:10611387}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0371170.0KT037117.1 Oryza sativa Indica Group cultivar Nonabokra abscisic acid inducible bZIP protein (TRAB1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650926.11e-171bZIP transcription factor TRAB1
SwissprotQ6ZDF31e-172TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBLA0A0D9X8T60.0A0A0D9X8T6_9ORYZ; Uncharacterized protein
STRINGLPERR08G14740.10.0(Leersia perrieri)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19290.14e-34ABRE binding factor 4
Publications ? help Back to Top
  1. Kagaya Y,Hobo T,Murata M,Ban A,Hattori T
    Abscisic acid-induced transcription is mediated by phosphorylation of an abscisic acid response element binding factor, TRAB1.
    Plant Cell, 2002. 14(12): p. 3177-89
    [PMID:12468735]
  2. Kobayashi Y, et al.
    Abscisic acid-activated SNRK2 protein kinases function in the gene-regulation pathway of ABA signal transduction by phosphorylating ABA response element-binding factors.
    Plant J., 2005. 44(6): p. 939-49
    [PMID:16359387]
  3. Kobayashi F,Maeta E,Terashima A,Takumi S
    Positive role of a wheat HvABI5 ortholog in abiotic stress response of seedlings.
    Physiol Plant, 2008. 134(1): p. 74-86
    [PMID:18433415]