PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR08G11550.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family LBD
Protein Properties Length: 434aa    MW: 47077.2 Da    PI: 4.6084
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR08G11550.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.42.8e-3966164199
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      aCaaCk++rrkC++dC +apyfpa+q+++f n+h+lFG+sn+lk+l++l++e  +dam++l+y+Ae+ra+dPv G+++vi +l++qle + ael
  LPERR08G11550.1  66 ACAACKYQRRKCNPDCRMAPYFPADQQRRFLNAHRLFGVSNILKTLRHLKPELCDDAMRTLIYQAEMRAHDPVLGCCRVIVDLERQLEIETAEL 159
                      7********************************************************************************************* PP

           DUF260  95 allke 99 
                      +++ +
  LPERR08G11550.1 160 NAVLH 164
                      98866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.81965166IPR004883Lateral organ boundaries, LOB
PfamPF031957.9E-3766162IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MTSTTTINNP ITTATPPPHH QRQQQQTHLP AAVAAARPPH STGSGSSGSH RGGGGGGSGS  60
GSTNQACAAC KYQRRKCNPD CRMAPYFPAD QQRRFLNAHR LFGVSNILKT LRHLKPELCD  120
DAMRTLIYQA EMRAHDPVLG CCRVIVDLER QLEIETAELN AVLHHLALCR QAAAAAGGGG  180
ASASVVAAAL PPGILDDPCA DLDVTSSNQP LLISAEQEVV DALYANQDAD AAILQGDNHQ  240
NQEQSQHEQH HGQQQLYDYF YYDSTVGDDV SSKPNLDINV DNMQHFDFDT SYDAENKVKL  300
TSDHIPVGVD EHSQIDSKEF ETKATPSLVD VFDMRHEQVD VNTDIVEVKE MVDMNADIEI  360
KTMVDMNVNI VDVVKTMVDV NADIDDVKTV VDVNGDIGVK EELPEEENGK AVAGKAPQMA  420
DSSHCKLGLG FSSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126161e-104CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
GenBankAP0149641e-104AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankAP0053881e-104AP005388.2 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OSJNBa0086F04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649280.10.0PREDICTED: uncharacterized protein LOC9266602
TrEMBLA0A0D9X7N50.0A0A0D9X7N5_9ORYZ; Uncharacterized protein
STRINGORGLA08G0122300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52283461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.12e-36LOB domain-containing protein 22