PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR08G01250.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MIKC_MADS
Protein Properties Length: 253aa    MW: 28732.9 Da    PI: 7.4975
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR08G01250.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF77.31.1e-241056248
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                     rien   rqvtf+kRr+g+lKKA ELSvLCda++ +iifs +gkly+
  LPERR08G01250.2 10 RIENPVHRQVTFCKRRAGLLKKARELSVLCDADIGIIIFSAHGKLYD 56
                     8********************************************97 PP

2K-box26.13.5e-1080157985
            K-box   9 leeakaeslqqelakLkkeienLqreqRhllGed.LesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 
                      ++  +    +qe+  Lk+ei+ Lq+ +R + G+   e ++++eL+ Le+ Le  + +iRs K  +  ++  + +k+  
  LPERR08G01250.2  80 ACGDQRMDPKQEAMVLKQEINLLQKGLRYIYGNRgNEHMTVEELNALERYLEIWMYNIRSAKVIHTESSYFTKKKRVV 157
                      4445555679**********************861578**********************997666666666666554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.576161IPR002100Transcription factor, MADS-box
SMARTSM004323.5E-35160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-27176IPR002100Transcription factor, MADS-box
CDDcd002653.68E-39279No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-26323IPR002100Transcription factor, MADS-box
PfamPF003192.2E-231055IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS512977.85585207IPR002487Transcription factor, K-box
PfamPF014869.3E-1286155IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MARGKVQLRR IENPVHRQVT FCKRRAGLLK KARELSVLCD ADIGIIIFSA HGKLYDLATT  60
GTMEELIERY KSASGEQANA CGDQRMDPKQ EAMVLKQEIN LLQKGLRYIY GNRGNEHMTV  120
EELNALERYL EIWMYNIRSA KVIHTESSYF TKKKRVVEFA KIFNLTDADN DPRDPSTQEQ  180
GKSYSLEGML KAANEILQEK IVEQNGLIDV GMMVADQQNG HFSKVPLIEE ITNPLTILSG  240
YSTCRGSEMG YSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A8e-16170169MEF2C
5f28_B8e-16170169MEF2C
5f28_C8e-16170169MEF2C
5f28_D8e-16170169MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR08G01250.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0033260.0AB003326.1 Oryza sativa Japonica Group mRNA for MADS box-like protein, complete cds, clone:R3786.
GenBankAK0691220.0AK069122.1 Oryza sativa Japonica Group cDNA clone:J023004P21, full insert sequence.
GenBankAY5519250.0AY551925.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS220 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650791.11e-145MADS-box transcription factor 26
SwissprotA2YQK91e-146MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G81e-146MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLA0A0D9X3S10.0A0A0D9X3S1_9ORYZ; Uncharacterized protein
STRINGLPERR08G01250.20.0(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.12e-49AGAMOUS-like 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Lee S, et al.
    Further characterization of a rice AGL12 group MADS-box gene, OsMADS26.
    Plant Physiol., 2008. 147(1): p. 156-68
    [PMID:18354041]
  3. Khong GN, et al.
    OsMADS26 Negatively Regulates Resistance to Pathogens and Drought Tolerance in Rice.
    Plant Physiol., 2015. 169(4): p. 2935-49
    [PMID:26424158]