PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR07G17900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family LBD
Protein Properties Length: 139aa    MW: 13888.5 Da    PI: 5.845
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR07G17900.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26022.62.9e-071366297
           DUF260 62 vyeAearardPvyGavgvilklqqqleqlkaelall 97
                     +yeA  r+ +Pv Gavg++++++++l+q+++e++l+
  LPERR07G17900.1  1 MYEAAGRTINPVGGAVGLLSSGSWHLCQAAVETVLR 36
                     6*****************************998775 PP

Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MYEAAGRTIN PVGGAVGLLS SGSWHLCQAA VETVLRGGGI GPMTDQLDAA SLAARRGVGC  60
STFSTAKRSA TRNTDAAAAR VGQPSCDLGL WLSPGSPPAV AAGERRAGTP SMNSEGSVTT  120
CGGAGGGERE EPELLNLFV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126151e-40CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
GenBankAP0149631e-40AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankAP0051491e-40AP005149.4 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OSJNBb0005G07.
GenBankAK0698131e-40AK069813.1 Oryza sativa Japonica Group cDNA clone:J023030F23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647207.13e-55PREDICTED: LOB domain-containing protein 37
TrEMBLA0A0D9X1073e-95A0A0D9X107_9ORYZ; Uncharacterized protein
STRINGORGLA07G0157700.14e-56(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40843675
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37540.11e-12LOB domain-containing protein 39