PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR07G04300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family CPP
Protein Properties Length: 772aa    MW: 83421.1 Da    PI: 6.7101
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR07G04300.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.34.9e-16453491240
              TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                       +k+C+CkkskClk+YCeCfaag++Cse C+C++C Nk 
  LPERR07G04300.1 453 ACKRCSCKKSKCLKLYCECFAAGVYCSEPCSCQGCLNKP 491
                      589**********************************96 PP

2TCR50.93e-16538577140
              TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce+CkN+ 
  LPERR07G04300.1 538 RHKRGCNCKKSSCLKKYCECYQGGVGCSSNCRCEGCKNTF 577
                      589***********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.8E-17452493IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.536453578IPR005172CRC domain
PfamPF036388.7E-12455490IPR005172CRC domain
SMARTSM011141.7E-17538579IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.0E-12540576IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 772 aa     Download sequence    Send to blast
MDSPLFSFID SLSPIEPLKS TYSASSIQAY QSLNITSISS IFTSPHDNAQ KELKLSKSSF  60
AEFSESEVCA DESDKNKPSK SSNAVRLFAC TSTLTQANQK MTSSASKGTV VPAEGLNDLP  120
QPGQFDTGSP DHNTRPCHGV RSDLKQGKVR KLQAFQTAKT NTSEKRKCLF STEVQLLDGS  180
QPGKLNDEIL GCEWDDLISA TSGELIAYDE DHKGVQLAVS NAESCGFLLS KLTGDGDISD  240
RTHPTSSTQT YYRELLMEED QTENAQLVLD GEKNISSEEI QDNLYEANEC IPTDYKVETQ  300
QQRGMRRRCL FFEAAGYSNR IMQKESVMDL SVSTGKGKSP VQNHPNPGKT PSPRVLRGIG  360
LHLNALALTP KGKMICQDPM TSLVPSSATQ QDAHGKLLSA GENFVNPGGD LLELQMDDDC  420
SAEIFLENDH DSSQSNSPQK KRRKADNGDD GEACKRCSCK KSKCLKLYCE CFAAGVYCSE  480
PCSCQGCLNK PIHEEIVLST RKQIEFRNPL AFAPKVIRTS DAGQDTGEDP NNTPASARHK  540
RGCNCKKSSC LKKYCECYQG GVGCSSNCRC EGCKNTFGKR DAAVSTEAEE MKQGVGEAEN  600
CGKEKENDLQ KANVQPEDHP FLELVPITPP FDVSSSLLKP PNFSSAKPPR PTKARTNSSR  660
SSSKAPGAVH SQKSSKIADS GSNEEMPDIL RNDASPGNCV KTSSPNGKRV SPPHNALSVS  720
PNRKGGRKLI LKSIPSFPSL IGDTSSGSSM NNSQSTFSTA SPLALGPSEA GC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1645557512120Protein lin-54 homolog
5fd3_B1e-1645557512120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1439443KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR07G04300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0658970.0AK065897.1 Oryza sativa Japonica Group cDNA clone:J013048O08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646690.10.0protein tesmin/TSO1-like CXC 2
TrEMBLA0A0D9WW370.0A0A0D9WW37_9ORYZ; Uncharacterized protein
STRINGLPERR07G04300.10.0(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.12e-85TESMIN/TSO1-like CXC 2