PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR07G02310.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 925aa    MW: 102589 Da    PI: 8.2323
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR07G02310.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.95.7e-09391435246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++WT+ E+++l+  v+q G+++W  Ia  +g++Rt+ qc  r+q 
  LPERR07G02310.1 391 NAWTAREEKKLILIVQQRGMNNWINIAVALGTHRTPFQCLARYQR 435
                      68*****************************************96 PP

2Myb_DNA-binding44.73.2e-14445488348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       W +eEd+ll  av+ +G++ W ++++ m  gRt++qc +rw+k l
  LPERR07G02310.1 445 DWAKEEDLLLEAAVNTFGPN-WQLVSASMD-GRTGNQCSNRWRKTL 488
                      69****************77.*********.************975 PP

3Myb_DNA-binding51.13.1e-16496541248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      grW+ +Ed++l  avk++G+g+W++Ia+ ++ gRt  qc +rw+++l
  LPERR07G02310.1 496 GRWSLDEDKRLMVAVKLFGSGSWNKIAQFIP-GRTQSQCNERWRNVL 541
                      8******************************.************986 PP

4Myb_DNA-binding33.97.4e-11548592247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHH.HHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIa.rtmgkgRtlkqcksrwqky 47 
                      g W +eEd +l+  v+++G+  W++Ia ++++ +Rt+++c  rw+k+
  LPERR07G02310.1 548 GEWRPEEDSKLLASVEEFGPC-WSKIAgAKIP-HRTDNMCLRRWRKL 592
                      68*****************88.****945777.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.842286384IPR017877Myb-like domain
SMARTSM007172.7E-5290386IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.1E-11292309IPR009057Homeodomain-like
CDDcd001676.41E-4349383No hitNo description
Gene3DG3DSA:1.10.10.608.1E-11356397IPR009057Homeodomain-like
PROSITE profilePS500908.792385437IPR017877Myb-like domain
SMARTSM007171.2E-5389439IPR001005SANT/Myb domain
SuperFamilySSF466891.59E-22389484IPR009057Homeodomain-like
PfamPF002499.0E-7391435IPR001005SANT/Myb domain
CDDcd001676.56E-6392437No hitNo description
Gene3DG3DSA:1.10.10.601.1E-10398448IPR009057Homeodomain-like
PROSITE profilePS5129411.567438488IPR017930Myb domain
SMARTSM007172.9E-12442490IPR001005SANT/Myb domain
PfamPF002492.8E-12445487IPR001005SANT/Myb domain
CDDcd001671.14E-9446488No hitNo description
Gene3DG3DSA:1.10.10.602.7E-14449491IPR009057Homeodomain-like
PROSITE profilePS5129419.971489545IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-18492543IPR009057Homeodomain-like
SMARTSM007173.0E-12494543IPR001005SANT/Myb domain
SuperFamilySSF466896.11E-26494589IPR009057Homeodomain-like
PfamPF002492.7E-15496541IPR001005SANT/Myb domain
CDDcd001672.82E-11497541No hitNo description
Gene3DG3DSA:1.10.10.607.6E-16544597IPR009057Homeodomain-like
SMARTSM007171.7E-8546595IPR001005SANT/Myb domain
PfamPF002494.4E-9548592IPR001005SANT/Myb domain
PROSITE profilePS5129413.57548597IPR017930Myb domain
CDDcd001671.35E-9549592No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 925 aa     Download sequence    Send to blast
MDFYSDDDDD SDAAFDEEFH NDMEAVRHSC IITGNDPDAA VAPVSDCLAA DAPAAAADGS  60
SDDDDEEEED DLALVRSIRE NLLLSKSSPS SPLTRPICAW PPSDSEDEDD DLETLRAIQR  120
RFSHYHSGTS SGSEIEMKTD ASKEWSVNLI ANGPDEEIDL EKQNNKEAIT RTGFPKAALL  180
LVDALKKNRA CQKFIRRKMI NIEAKIEENK DLRDRVKCLL DYQLSCRKAF GKMLCQKEDP  240
RVRLISSQKP CAQSSKNKDK KMPALFLGPA DNPHVSKYKM VLKQFPMSLQ KQPWSDVEKD  300
KLAKGLKQQY QEALILNSMN NGSSAGDFSA VDMAYALTNT AGNFEVTPES LRSVLPLINW  360
DKISAMYLPG RSGAECESRW LNWDDPLINH NAWTAREEKK LILIVQQRGM NNWINIAVAL  420
GTHRTPFQCL ARYQRSLNHC ILNKDWAKEE DLLLEAAVNT FGPNWQLVSA SMDGRTGNQC  480
SNRWRKTLNP ERSRVGRWSL DEDKRLMVAV KLFGSGSWNK IAQFIPGRTQ SQCNERWRNV  540
LDPDIDLGEW RPEEDSKLLA SVEEFGPCWS KIAGAKIPHR TDNMCLRRWR KLCQHKLPSV  600
KAAQQIKKAI FQSNFVDRET ERPAIAPSDL MSLVSSKVDA SHENSASAQV KKPRKGSRIP  660
CEDNILPSDT LNSSTPMNLS MDAEAAVNTT TSSSRKKPSR SRTKKQTDEN LAVPDDANNS  720
SNCSSGARKR KRSITDNNQV AQKKSGCSTS VDNEVGTKGK AGSTSVGEEG TAKKRRMRGS  780
LSGKEGEVNK RMRGSVSGVH EGATKQRRGS VSTDNHGVVM KSKRAPSRKS AKESSTVDNK  840
ANEERDANTG NVNNVKHMSM PIPKQINMIE GSAQINGPTR VARHLYVSVR PVNNMVLSNG  900
LSDDVSAIAV PTGPDPISVE NSNTA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-233626528157MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-233626528157MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0654520.0AK065452.1 Oryza sativa Japonica Group cDNA clone:J013025M19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647432.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647433.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647435.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647436.10.0PREDICTED: myb-like protein L isoform X1
RefseqXP_015647437.10.0PREDICTED: myb-like protein L isoform X1
TrEMBLA0A0D9WVC20.0A0A0D9WVC2_9ORYZ; Uncharacterized protein
STRINGBGIOSGA024846-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os07g04700.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-150myb domain protein 4r1