PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR06G15680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family GATA
Protein Properties Length: 362aa    MW: 38974.4 Da    PI: 9.8162
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR06G15680.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.81.3e-17184217134
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                      Cs C+ttkTplWR+gp g+k+LCnaCG+++rk +
  LPERR06G15680.1 184 CSDCNTTKTPLWRSGPCGPKSLCNACGIRQRKVR 217
                      *******************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577166.65E-13176218No hitNo description
SMARTSM004011.5E-16178230IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.104.1E-14182216IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011412.321182214IPR000679Zinc finger, GATA-type
CDDcd002021.54E-14184220No hitNo description
PfamPF003202.3E-15184217IPR000679Zinc finger, GATA-type
PROSITE patternPS003440184209IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009910Biological Processnegative regulation of flower development
GO:0010187Biological Processnegative regulation of seed germination
GO:0010255Biological Processglucose mediated signaling pathway
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MSTIYVSQLS SALPLMEGDH HHHHHHQDHH QGHFQGFSLP KDPPILFPFV ITSSSSSPSD  60
TSTLSYGSDH HLRQQQQHAM LEPQHMIRGS PFATAPFPTV ESIRDDMIER SQFDPYDTEK  120
LQVSCGSANK VIAGAKWSAT PAAKMKITRK ESDPPTVKKP RRRAQAYKDH HGAMAQAFGV  180
IRMCSDCNTT KTPLWRSGPC GPKSLCNACG IRQRKVRRAM MASGSPAAAV PAAAQPQTKV  240
KKEKRADVDR SLPFKKRCKV VQVQQNQIAP STTTKAAVAA VTEETAESAT VDVAATAPAP  300
TRGGALVDSI GLSWSKIPAA TTATASCSFR PSPPVALAAA VQDEITDAAM LLMTLSCGLV  360
RS
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters (By similarity). Influences the expression of nuclear encoded chloroplast-targeted genes. Regulates chloroplast development and promotes chlorophyll accumulation. Modulates plant architecture (e.g. height, length and width of leaf blades, and flowering tillers production) and represses tillering, probably by modulating number of cells. Promotes senescence. Involved in grain filling, panicle development and starch production (PubMed:23548780). {ECO:0000250|UniProtKB:Q9SZI6, ECO:0000269|PubMed:23548780}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR06G15680.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by light, nitrogen, and cytokinin (benzyladenine) treatments, but repressed by darkness and gibberellin (GA). {ECO:0000269|PubMed:23548780}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0698514e-86AK069851.1 Oryza sativa Japonica Group cDNA clone:J023034D16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641328.11e-140protein CYTOKININ-RESPONSIVE GATA TRANSCRIPTION FACTOR 1-like
RefseqXP_015641329.11e-140protein CYTOKININ-RESPONSIVE GATA TRANSCRIPTION FACTOR 1-like
RefseqXP_025882362.11e-140protein CYTOKININ-RESPONSIVE GATA TRANSCRIPTION FACTOR 1-like
SwissprotQ6YW484e-71CGA1_ORYSJ; Protein CYTOKININ-RESPONSIVE GATA TRANSCRIPTION FACTOR 1
TrEMBLA0A0D9WRE40.0A0A0D9WRE4_9ORYZ; Uncharacterized protein
STRINGLPERR06G15680.10.0(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP18933899
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56860.14e-19GATA family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Behringer C,Schwechheimer C
    B-GATA transcription factors - insights into their structure, regulation, and role in plant development.
    Front Plant Sci, 2015. 6: p. 90
    [PMID:25755661]