PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR06G05720.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family ARF
Protein Properties Length: 1394aa    MW: 152544 Da    PI: 6.8339
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR06G05720.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.97.8e-23127228199
                      EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                      f+k+lt sd++++g +++p++ ae++       ++++++  +l+ +d++  sW++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F   ++
  LPERR06G05720.2 127 FCKTLTASDTSTHGGFSVPRRAAEKIfppldftMQPPAQ--ELIAKDLHDISWKFRHIYRGQPKRHLLTTGWSVFVSTKRLLAGDSVLFI--RD 216
                      99*****************************96555444..8************************************************..45 PP

                      SEE..EEEEE-S CS
               B3  88 sefelvvkvfrk 99 
                      ++ +l+++++r+
  LPERR06G05720.2 217 EKSQLLLGIRRA 228
                      677789999997 PP

2Auxin_resp122.43.3e-40253335183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      aahaa+++s+F+++YnPras+seFv++++k++kal+++vs+GmRf+m feteds  rr++Gt++g+ dldpvrW+nS+Wr+L+
  LPERR06G05720.2 253 AAHAAANSSPFTIFYNPRASPSEFVIPLAKYNKALYTQVSLGMRFRMLFETEDSGVRRYMGTITGIGDLDPVRWKNSHWRNLQ 335
                      79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.66E-44117256IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.1E-40119242IPR015300DNA-binding pseudobarrel domain
CDDcd100178.21E-20126227No hitNo description
SMARTSM010195.1E-23127229IPR003340B3 DNA binding domain
PfamPF023627.2E-21127228IPR003340B3 DNA binding domain
PROSITE profilePS5086312.224127229IPR003340B3 DNA binding domain
PfamPF065075.4E-35253335IPR010525Auxin response factor
PfamPF023091.2E-59391031IPR033389AUX/IAA domain
PROSITE profilePS5174524.4739451029IPR000270PB1 domain
SuperFamilySSF542775.4E-79631024No hitNo description
SuperFamilySSF501294.94E-2612011294IPR011032GroES-like
SMARTSM008833.2E-3712021293IPR020818GroES chaperonin family
HamapMF_0058022.07212021294IPR020818GroES chaperonin family
Gene3DG3DSA:2.30.33.402.7E-2912021294IPR020818GroES chaperonin family
CDDcd003202.09E-3612021293IPR020818GroES chaperonin family
PROSITE patternPS00681012031227IPR018369Chaperonin GroES, conserved site
PfamPF001668.4E-2712031292IPR020818GroES chaperonin family
HamapMF_0058021.72313001394IPR020818GroES chaperonin family
SMARTSM008833.7E-4113001393IPR020818GroES chaperonin family
SuperFamilySSF501291.53E-2613001393IPR011032GroES-like
Gene3DG3DSA:2.30.33.402.6E-3413001393IPR020818GroES chaperonin family
PRINTSPR002974.1E-2213011316IPR020818GroES chaperonin family
PfamPF001662.4E-2713011392IPR020818GroES chaperonin family
PROSITE patternPS00681013011325IPR018369Chaperonin GroES, conserved site
CDDcd003201.42E-3613021393IPR020818GroES chaperonin family
PRINTSPR002974.1E-2213231344IPR020818GroES chaperonin family
PRINTSPR002974.1E-2213581370IPR020818GroES chaperonin family
PRINTSPR002974.1E-2213801393IPR020818GroES chaperonin family
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006457Biological Processprotein folding
GO:0009723Biological Processresponse to ethylene
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010311Biological Processlateral root formation
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0005524Molecular FunctionATP binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 1394 aa     Download sequence    Send to blast
MKDQGSSGVS PGPAEGEKKA INSELWHACA GPLVSLPPVG SLVVYFPQGH SEQVAASMHK  60
ELDNIPGYPS LPSKLICKLL SLTLHADSET DEVYAQMTLQ PVNKYERDAM LASELGLKQN  120
KQPAEFFCKT LTASDTSTHG GFSVPRRAAE KIFPPLDFTM QPPAQELIAK DLHDISWKFR  180
HIYRGQPKRH LLTTGWSVFV STKRLLAGDS VLFIRDEKSQ LLLGIRRATR PQPALSSSVL  240
SSDSMHIGIL AAAAHAAANS SPFTIFYNPR ASPSEFVIPL AKYNKALYTQ VSLGMRFRML  300
FETEDSGVRR YMGTITGIGD LDPVRWKNSH WRNLQVGWDE STASERRTRV SIWEIEPVAT  360
PFYICPPPFF RPKLPKQPGM PDDENEVESA FKRAMPWLAD DFALKDVQSA LFPGLSLVQW  420
MAMQQNPQML TAASPTVQSP YLTSNTLAMQ DVMGSSNEDP TKRLNAQAQN IVLPNLQVGS  480
KVDHPVMTQH QQQQHQLAQQ QQHQLAQQQQ QVQPSQQSSV VLQQHQAQLM QQNAIHLQQQ  540
QEHLQRQQSQ PTQQLKTAAS LHSVEQHKLK EQTSGGQVAS QAQLLNQIFP PSSSQLQQLG  600
LPKSPTQRQG LTGLPISGSL QQPTLTQTSQ AQQAAEYQQA LLQSQQHQLQ QLSQPEVQLQ  660
LLQKIQQQNM LSQLNPQHQS QLIQQLSQKS QEILQQQILQ HQFGGSDAVG QLKQSPSQQT  720
PLNHIAGSLT PQQLVRSHSA LAESGEPSSS TAPSASRISP MNSLGRAHQG SRNFSDMVAT  780
PHIDSLLQEI QSKPDNRIKN DIHSKETVAI PNRHPVSDQL DASSATSFCL DESPREGFSF  840
PPVCLDNNVQ VDPRDSFLIA ENVDAMMPDA LLSRGMASGK GMCNLTSGQR DHRDVENELS  900
SAAFSSQSFG VPDMSFKPGC SSDVAVADAG MPSQGLWNNQ TQRMRTFTKV QKRGSVGRSI  960
DITRYRDYDE LRHDLACMFG IQGQLEDPYR MDWKLVYVDH ENDILLVGDD PWEEFVGCVK  1020
SIKILSAAEV QQMSLDGDLG GVPSQTQACS ASDDANAWRV SKAAYLDRSD QVVRPDSTTF  1080
QNHLVRPNPV AAAPTGNLSL WNTVPHPNPL TTPRIPNPAD SKPEQDKPGG FEINQLFSQQ  1140
LRMSSVQLSG AGVAAVAFTK KGASSFDGLR LAPPSARVCS SRRPSRSLVV KAATVVTPKY  1200
TSLKPLGDRV LVKLGAAEEK TVGGILLPTT AQSKPQGGEV VAVGEGKTIG DKKVEVSVPI  1260
GAEVVYSKYA GTEVEFNDSK HLLLKEDDII GILESDDAKD MKPLSDRVLI KVAEAEDKTA  1320
GGLILTETTK EKPSIGTVVA VGPGPLDDEG KRQPLSVSAG STVLYSKYAG SEFKGADGTN  1380
YIVLRVSDVM AVLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1621735647388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1033270.0AK103327.1 Oryza sativa Japonica Group cDNA clone:J033125L14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006656735.10.0PREDICTED: auxin response factor 16 isoform X1
SwissprotA3B9A00.0ARFP_ORYSJ; Auxin response factor 16
TrEMBLA0A0D9WMX40.0A0A0D9WMX4_9ORYZ; Auxin response factor
STRINGOB06G15720.10.0(Oryza brachyantha)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19