PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR05G18660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family ARF
Protein Properties Length: 704aa    MW: 76417.8 Da    PI: 7.2912
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR05G18660.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B366.15.3e-21134251199
                      EEEE-..-HHHHTT-EE--HHH.HTT...............---..--SEEEEEETTS-EEEEEE.........EEETTEEEE-TTHHHHHHHH CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh...............ggkkeesktltledesgrsWevkliy.......rkksgryvltkGWkeFvkan 72 
                      f+k+lt sd++++g +++p++ ae++               + +   s++l+ +d++g +W++++iy       +++++r++lt+GW++Fv+ +
  LPERR05G18660.1 134 FCKTLTASDTSTHGGFSVPRRAAEDCfpplviqltsnlydyKTIR-PSQELIAMDLHGTQWKFRHIYrvlgkgqKGQPRRHLLTTGWSSFVNRK 226
                      99******************************9999999863332.4569********************9888888888************** PP

                      T--TT-EEEEEE-SSSEE..EEEEE-S CS
               B3  73 gLkegDfvvFkldgrsefelvvkvfrk 99 
                      +L +gD v F   + ++++l+++v+r+
  LPERR05G18660.1 227 KLVSGDAVFFL--RGDDGQLRLGVRRA 251
                      ***********..34888899999986 PP

2Auxin_resp107.91.1e-35276356182
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                      +a+++++ks+F+v++nPr+++seF+v+++++ k+l++++s+GmRfk+ +e+eds+er+ sG+v+++s++dp+rWp+S+W++L
  LPERR05G18660.1 276 VASSLENKSIFHVCFNPRSGASEFIVPYWRFTKSLNHPFSIGMRFKICYEGEDSNERS-SGLVSSISEVDPIRWPGSRWKCL 356
                      578899***************************************************9.9*********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.75E-36124285IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.8E-33129252IPR015300DNA-binding pseudobarrel domain
CDDcd100172.98E-19132250No hitNo description
PfamPF023627.6E-19134251IPR003340B3 DNA binding domain
SMARTSM010191.2E-16134252IPR003340B3 DNA binding domain
PROSITE profilePS5086311.632134252IPR003340B3 DNA binding domain
PfamPF065075.5E-29277356IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 704 aa     Download sequence    Send to blast
MGIDLNTVDE EESEASATPV VCGELWHACA GPGVALPRRG SAVVYLPQAH LATGGGGGGD  60
VPPGAVAVPP HVACRVVDVE LRADAATDEV YARLALVAEG EMLRRNFHDG GGEDGAEETE  120
GCDTEKKPRM PHMFCKTLTA SDTSTHGGFS VPRRAAEDCF PPLVIQLTSN LYDYKTIRPS  180
QELIAMDLHG TQWKFRHIYR VLGKGQKGQP RRHLLTTGWS SFVNRKKLVS GDAVFFLRGD  240
DGQLRLGVRR AVPLRNEALF EPVNSSDSKL RILSSVASSL ENKSIFHVCF NPRSGASEFI  300
VPYWRFTKSL NHPFSIGMRF KICYEGEDSN ERSSGLVSSI SEVDPIRWPG SRWKCLVVRW  360
DDSTDSSHQN RVSPWDIERV SGSVSATHSL SSSSSKRTKL HFPQGNLDTP FLNGNGNPDS  420
METGNFHRVL QGQEFRGSRS LGAVCSEPPG VPFFQAPDNR RFSADMQGYM MPASGPLRQN  480
TQFTYQPVGF GESLRFPEVL QGQEMSQAVP LFRGASFGAH TQNGRVVSAN SLPRSAAPTG  540
FPAATQGLPV SQFALSASKV SSPSSVLMFN QATAPHLEPE SGTNNKGIHG SQFFSQEMLI  600
DTVTWPGIQH KMSSEITSNP FAMAKTSAPS SRAESGSPKR DSGRSSCRLF GFSLTENMLG  660
EEGEGLEEES NKADCQGPRV LELFGRRHST PGALRALCAA PLGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldy_A6e-892137819353Auxin response factor 1
4ldy_B6e-892137819353Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637659.10.0PREDICTED: auxin response factor 14
SwissprotQ0DGS10.0ARFN_ORYSJ; Auxin response factor 14
TrEMBLA0A0D9WIM90.0A0A0D9WIM9_9ORYZ; Auxin response factor
STRINGLOC_Os05g43920.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51132756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.11e-130ARF family protein