PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR05G13240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family LBD
Protein Properties Length: 261aa    MW: 25730.4 Da    PI: 7.3885
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR05G13240.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.12.9e-3853135183
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilkl 83 
                      +CaaCk+lrrkC++dCv+apyfp ++p+kf  vh++FGasnv+kll++l++ +reda++sl+yeA++r+rdPvyG+vg   + 
  LPERR05G13240.1  53 PCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELHPYQREDAVNSLAYEADMRLRDPVYGCVGAAAAA 135
                      7*****************************************************************************87665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.1452153IPR004883Lateral organ boundaries, LOB
PfamPF031954.9E-3853135IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MASSSASSLP LSSGSVITVS SSSAVGASSG NTATASAGAG GGVAGSGAGT GSPCAACKFL  60
RRKCQPDCVF APYFPPDNPQ KFVHVHRVFG ASNVTKLLNE LHPYQREDAV NSLAYEADMR  120
LRDPVYGCVG AAAAAAVSSS NGQSPAAMAD FIGSTVPNCT QNFINGSHTV VAASAIGGGF  180
VHDNQFATVQ MLTRSYDGGE NAVARLGGAV NGGGGGYEYG YSSTMNGGGG GPMSGLGPLG  240
GGTFLKPGTT GCGGERPTAA Q
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY7955601e-112AY795560.1 Triticum aestivum AS2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640070.11e-102PREDICTED: LOB domain-containing protein 6
RefseqXP_015640071.11e-102PREDICTED: LOB domain-containing protein 6
SwissprotQ32SG36e-89LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLA0A0D9WGK10.0A0A0D9WGK1_9ORYZ; Uncharacterized protein
STRINGLOC_Os05g34450.11e-102(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.42e-50LBD family protein