PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR05G13000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 647aa    MW: 68710 Da    PI: 8.8957
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR05G13000.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.23.6e-13172233162
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                      e++ +r+ r+++NRe+A+ sRqRKk ++eeLeekvk++ +   +L ++++    e a+l+++
  LPERR05G13000.1 172 EEDKRRAARLMRNRESAQLSRQRKKRYVEELEEKVKSMHSVINDLNSRISFVVAENATLRQQ 233
                      5677899*********************************9999***999888888888877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.0E-14171236IPR004827Basic-leucine zipper domain
PfamPF001701.1E-10173234IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.979174234IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.69E-11176234No hitNo description
Gene3DG3DSA:1.20.5.1701.3E-15176235No hitNo description
CDDcd147043.39E-20177228No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 647 aa     Download sequence    Send to blast
MAESALLDPS PFDLRHYPAH LFDPDLPLAA GGGGGDDDNL PLGAFDGLEF DLPGDFSVED  60
FLLRSPDRGD DSGEGSAAGS AGPVASPSSP TTSGSNSAVA NGSCEVKHEE SDEGRSGADP  120
DPKWSLKRKQ ASPGLSSDAA KCRRSGDGDV SPSASASRTA VDSDEGGTVC EEEDKRRAAR  180
LMRNRESAQL SRQRKKRYVE ELEEKVKSMH SVINDLNSRI SFVVAENATL RQQLSGGSAN  240
CPPPGVYPPP PIPGMPFPWV PGYAMRPHGS HVPLVPIPRL KSQQPMPASK VAKKPETKKN  300
VENKSKTKTK TKKVASVSLL GLLLMMLVFG AFIPGFNHNF GMGGQSNNAV FRNFVQSHAR  360
VLSSSSQDKS NLSHSDMIGV DVGKRTGSTD GSGKKHQSAD NSSEILPALL YVPRNGKHVK  420
INGNLIIHSV LASEKAVAHK ASKGDSAQSA KDHKETSVAI ARYLSLPGKD MNQQETSSPD  480
GPLPQWFREG MAGPILNSGM CSEVFQFDIS AASNNPGGII PASPVVNSSS VNATEKIPAH  540
SAAYHGKLKN RRVMYNEAIP LTGKTVNNTE PFNRTSEGRK LPDSKPASSV VVSVLADPRE  600
AGNGDGDPRV SPKSLSKIFV VVLVDGSRYV TYSCTLPFKS ASPHLVN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1174196KRRAARLMRNRESAQLSRQRKKR
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in endoplasmic reticulum (ER) stress response. Acts as ER stress sensor and activates the transcription factor BZIP50 and the chaperone BIP1. {ECO:0000269|PubMed:22050533, ECO:0000269|PubMed:22084314}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR05G13000.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by dithiothreitol- and tunicamycin-induced endoplasmic reticulum (ER) stress response. {ECO:0000269|PubMed:22084314}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0731420.0AK073142.1 Oryza sativa Japonica Group cDNA clone:J033024D10, full insert sequence.
GenBankCT8320400.0CT832040.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA222G20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006655320.20.0PREDICTED: bZIP transcription factor 17-like
SwissprotQ6AU900.0BZP39_ORYSJ; bZIP transcription factor 39
TrEMBLA0A0D9WGH60.0A0A0D9WGH6_9ORYZ; Uncharacterized protein
STRINGLPERR05G13000.10.0(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82283545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.15e-85bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Cheng CH, et al.
    A fine physical map of the rice chromosome 5.
    Mol. Genet. Genomics, 2005. 274(4): p. 337-45
    [PMID:16261349]
  3. Takahashi H,Kawakatsu T,Wakasa Y,Hayashi S,Takaiwa F
    A rice transmembrane bZIP transcription factor, OsbZIP39, regulates the endoplasmic reticulum stress response.
    Plant Cell Physiol., 2012. 53(1): p. 144-53
    [PMID:22084314]
  4. Ohta M, et al.
    Analysis of rice ER-resident J-proteins reveals diversity and functional differentiation of the ER-resident Hsp70 system in plants.
    J. Exp. Bot., 2013. 64(18): p. 5429-41
    [PMID:24153418]
  5. Cheng Q, et al.
    An alternatively spliced heat shock transcription factor, OsHSFA2dI, functions in the heat stress-induced unfolded protein response in rice.
    Plant Biol (Stuttg), 2015. 17(2): p. 419-29
    [PMID:25255693]