PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR05G04040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family LBD
Protein Properties Length: 249aa    MW: 25895.2 Da    PI: 8.369
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR05G04040.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.14e-40661661101
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca++C+++pyf   +p+kfa vhk+FGasnv+k+l +++e++r da++slvyeA+ r+rdPvyG++g il+lqqq++ l++el
  LPERR05G04040.1  66 PCAACKLLRRRCAQECPFSPYFSPLEPHKFASVHKVFGASNVSKMLLEVHESQRGDAANSLVYEANLRLRDPVYGCMGAILNLQQQVHALESEL 159
                      7********************************************************************************************* PP

           DUF260  95 allkeel 101
                      a++++++
  LPERR05G04040.1 160 AAVRAQI 166
                      **99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.44465166IPR004883Lateral organ boundaries, LOB
PfamPF031957.3E-4066163IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MSTASDWQDH YEVGRKIIKR ESALSAADAA AASADDGRMM ARRSCSTPAA AAGAGPGSAA  60
VNTITPCAAC KLLRRRCAQE CPFSPYFSPL EPHKFASVHK VFGASNVSKM LLEVHESQRG  120
DAANSLVYEA NLRLRDPVYG CMGAILNLQQ QVHALESELA AVRAQIVSHK YRSSPATATT  180
VLPSSHASQL LAGRLPVAAA GTMGVTTATL PAVASASSST TTAAVYAAAA ASSSTDYSSI  240
TNENVPYFS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638927.11e-108PREDICTED: LOB domain-containing protein 15 isoform X1
SwissprotQ9AT612e-68LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A0D9WD760.0A0A0D9WD76_9ORYZ; Uncharacterized protein
STRINGORGLA05G0042200.11e-103(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.14e-65LOB domain-containing protein 13