PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR05G01520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family LBD
Protein Properties Length: 204aa    MW: 21226.4 Da    PI: 6.4869
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR05G01520.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.51.9e-42311301100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+C++ Cvlapyfp ++p+kf  +h++FGasn++kll++lpee+r da+ss+vyeA+ar+rdPvyG++g i +lq+q ++lka+l
  LPERR05G01520.1  31 PCAACKILRRRCVDRCVLAPYFPPTDPHKFTTAHRVFGASNIIKLLQELPEENRADAVSSMVYEANARIRDPVYGCAGAICQLQKQANELKAQL 124
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++ 
  LPERR05G01520.1 125 ARAQAD 130
                      *99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.86930131IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-4231128IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MGSSSIDTAC TVDATTPTSP ATMATTVVMS PCAACKILRR RCVDRCVLAP YFPPTDPHKF  60
TTAHRVFGAS NIIKLLQELP EENRADAVSS MVYEANARIR DPVYGCAGAI CQLQKQANEL  120
KAQLARAQAD LAAARASHAH LVALLCMEMA ASASASPPPP TTPAAYSQLA AAAPVDALYV  180
VDGAGAAGAA MASPIGWVDE PLWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638880.11e-104PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR02e-61LBD1_ARATH; LOB domain-containing protein 1
SwissprotQ9SK087e-61LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A0D9WC801e-147A0A0D9WC80_9ORYZ; Uncharacterized protein
STRINGORGLA05G0016500.11e-99(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26453790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.14e-52LOB domain-containing protein 1