PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR04G24160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family ARF
Protein Properties Length: 899aa    MW: 99416.2 Da    PI: 6.0826
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR04G24160.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B367.91.4e-21143233186
                      EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                      f+k lt sd++++g +++p++ ae+       ++++++ ++l+++d++ + W++++iyr++++r++lt+GW+ Fv a++Lk+gD+v+F +++
  LPERR04G24160.1 143 FCKNLTASDTSTHGGFSVPRRAAEKLfpqldySMQPPN-QELIVRDLHDNMWTFRHIYRGQPKRHLLTTGWSLFVGAKRLKAGDSVLFIRTS 233
                      89*********************999*****9555555.49***********************************************9544 PP

2Auxin_resp89.27.8e-302312961883
       Auxin_resp  18 rastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      r+s+s Fv++v++++ka++++ svGmRf m+fete+ss+rr++Gt+vg+sd+dp+rWpnSkWr+L+
  LPERR04G24160.1 231 RTSPSPFVIPVARYNKATYMQPSVGMRFAMMFETEESSKRRYTGTIVGISDYDPMRWPNSKWRNLQ 296
                      799*************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019365.76E-40133238IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.1E-34136237IPR015300DNA-binding pseudobarrel domain
CDDcd100173.02E-19142229No hitNo description
PfamPF023622.5E-19143234IPR003340B3 DNA binding domain
PROSITE profilePS5086312.182143245IPR003340B3 DNA binding domain
SMARTSM010194.2E-18143247IPR003340B3 DNA binding domain
PfamPF065073.7E-25231296IPR010525Auxin response factor
PfamPF023093.2E-10788883IPR033389AUX/IAA domain
PROSITE profilePS5174525.592796880IPR000270PB1 domain
SuperFamilySSF542771.05E-8799875No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009908Biological Processflower development
GO:0009942Biological Processlongitudinal axis specification
GO:0010305Biological Processleaf vascular tissue pattern formation
GO:0048364Biological Processroot development
GO:0048507Biological Processmeristem development
GO:0005634Cellular Componentnucleus
GO:0016020Cellular Componentmembrane
GO:0042802Molecular Functionidentical protein binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 899 aa     Download sequence    Send to blast
MASSQEKAKS GVLRNAAALL DEMQLLGETQ GAKKVINSEL WHACAGPLVC LPQRGSLVYY  60
FPQGHSEQVA ATTRKIPNSR IPNYPNLPSQ LLCQVHNITL HADKDTDEVY AQMTLQPVNS  120
ETDVFPIPTL GTYTKSKHPT EYFCKNLTAS DTSTHGGFSV PRRAAEKLFP QLDYSMQPPN  180
QELIVRDLHD NMWTFRHIYR GQPKRHLLTT GWSLFVGAKR LKAGDSVLFI RTSPSPFVIP  240
VARYNKATYM QPSVGMRFAM MFETEESSKR RYTGTIVGIS DYDPMRWPNS KWRNLQVEWD  300
EHGYGERPER VSIWDIETPE NTLAFPSTLT SKRQCLPGYG VPGLEIGSGN MSPFQRAQGN  360
PYGNLQHIPA VGSELAIMLL NQSGQNLGIP HSYHQSSDAS IIQNVKQNYI PPLTISTSAC  420
STKLESLPSD DDQRQFHMAN LQNGDLESSE AQPVIDSISQ SKLNVTSRDP RTTDSYPSRS  480
LSEQNSKGEP RGKTRRSKKS MSHKTISEKS DLSSAPSWTC DNQQVGLESK LVSCGEQVNC  540
GVVEDSSGAL TQGNFAGQPH CHQVEQNELL SPSPPKVESS KSPDGGKSVN SFPNQGCFSQ  600
FIDGLDWMTQ PSYYQDSSAI HPVDASEHIL SSSADIPATV MADTMETFQA SCLSDCIPNS  660
IQEFISSPDL NSLTFLSPEM QNLEVQLQHD GSNLPSTSNS LVQMSFSEES GNHSANLSGL  720
HMESTHRSIN TTSCSQPLST GGFDTGMYSK LPHLKESQIL SLPEIHTNSM GTSACSMDAT  780
EYNLDRSTKP VKPPVRTFTK VQKQGSVGRS IDVTGFRNYH ELRSAIACMF GLQGKLEHPG  840
SSEWKLVYVD YENDVLLVGD DPWEEFINCV RCIRILSPSE VQQMSENGMH VLNDCIQTA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1601731931390Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0712920.0AB071292.1 Oryza sativa OsMP mRNA for Arabidopsis Monopteros-like protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634367.10.0PREDICTED: auxin response factor 11-like
SwissprotQ01K260.0ARFK_ORYSI; Auxin response factor 11
SwissprotQ8S9830.0ARFK_ORYSJ; Auxin response factor 11
TrEMBLA0A0D9WAT50.0A0A0D9WAT5_9ORYZ; Auxin response factor
STRINGBGIOSGA014158-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86733241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19850.11e-166ARF family protein