PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR04G22430.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 369aa    MW: 41759.4 Da    PI: 7.9267
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR04G22430.3genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.71.9e-1178116341
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeae 41 
                      ++k+ rr+++NReAAr+sR+RKka+i++Le+   +L + 
  LPERR04G22430.3  78 PDKVLRRLAQNREAARKSRLRKKAYIQQLETSRLKLAQL 116
                      789***************************854444333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.6E-874125No hitNo description
SMARTSM003381.1E-1076140IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.93378122IPR004827Basic-leucine zipper domain
PfamPF001704.6E-878118IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.34E-780125No hitNo description
PROSITE patternPS0003608398IPR004827Basic-leucine zipper domain
PfamPF141443.1E-26168242IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MTLASTQFAA PVRMGAYDRP PPVGMWSHEQ FKVDNGQATS ASTIMESEMK YEARLEEVPQ  60
VVLDQEARNV DQEASKSPDK VLRRLAQNRE AARKSRLRKK AYIQQLETSR LKLAQLEQEL  120
QRARQQSVYA NGGLREPNLG FTGAIDPGAV NFEIEYSHWV DEQNRNTGEL RNALLQAQTT  180
EDELKLLVEI GLENYSRLFN IKKDAANSDV FYVMSGMWKT PTERFFLWIG GFRPSEVLKN  240
LRPQLEPLLE HQIVSVNGLQ HSSMQAEDAL SQGMDKLKQT IADSLTAADP FGSPDAYMVH  300
MANAVEQLKS LVKFVIQADH LRHTTLLEMR RILTTRQAAR GLVALGDYLQ RFRALSSLWT  360
ARPRDSGIS
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator involved in defense response. {ECO:0000250|UniProtKB:Q7X993}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00502DAPTransfer from AT5G10030Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR04G22430.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025880678.10.0transcription factor TGAL6 isoform X3
SwissprotA0A0P0WFC80.0TGAL6_ORYSJ; Transcription factor TGAL6
TrEMBLA0A0D9WA410.0A0A0D9WA41_9ORYZ; Uncharacterized protein
STRINGLPERR04G22430.20.0(Leersia perrieri)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10030.21e-118TGACG motif-binding factor 4
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Okada A, et al.
    OsTGAP1, a bZIP transcription factor, coordinately regulates the inductive production of diterpenoid phytoalexins in rice.
    J. Biol. Chem., 2009. 284(39): p. 26510-8
    [PMID:19635799]
  3. Okada K
    The biosynthesis of isoprenoids and the mechanisms regulating it in plants.
    Biosci. Biotechnol. Biochem., 2011. 75(7): p. 1219-25
    [PMID:21737944]
  4. Yamane H
    Biosynthesis of phytoalexins and regulatory mechanisms of it in rice.
    Biosci. Biotechnol. Biochem., 2013. 77(6): p. 1141-8
    [PMID:23748776]
  5. Miyamoto K, et al.
    Identification of target genes of the bZIP transcription factor OsTGAP1, whose overexpression causes elicitor-induced hyperaccumulation of diterpenoid phytoalexins in rice cells.
    PLoS ONE, 2014. 9(8): p. e105823
    [PMID:25157897]
  6. Miyamoto K, et al.
    Overexpression of the bZIP transcription factor OsbZIP79 suppresses the production of diterpenoid phytoalexin in rice cells.
    J. Plant Physiol., 2015. 173: p. 19-27
    [PMID:25462074]