PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR04G18520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family GRAS
Protein Properties Length: 634aa    MW: 66373 Da    PI: 7.8719
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR04G18520.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS297.14.6e-912676342374
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      ++lL e+A a+++g++e a + La l+  a+++gd  qRl+a+++ AL++r+a+     +++ p+++ +e  s+e+ a  +l++++sP+++++ 
  LPERR04G18520.1 267 RQLLSEAAAAIADGHHETAATHLAALKRAANSRGDVEQRLVAMMVAALSSRIAQ-----ASSSPSQHLQELCSAEQRAGSQLLHDISPCFRLAL 355
                      689***************************************************.....4444555555455788888889************* PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfefnvlvakr 185
                       +aN aI++av  ++++H +Dfd+s + Q + L++ La+R+ +  s+RiT+v +p+s      + +l ++ge+L+k+Ae+ g++ +f++ v+ r
  LPERR04G18520.1 356 HAANVAIVDAVGDHRAIHLVDFDVSAPQQ-ADLIRRLAARRLPGTSIRITAVTDPTSPftqpLAATLPAVGEQLQKLAERAGIEYRFKM-VSCR 447
                      *************************9977.9***********************99888888889999********************9.7899 PP

             GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                       +++e ++L ++ gEalaVnl+++l +++desvs +++rde+L+ v+ l P+vv +veqe++ n++++++rf++a+ +y a+++sl+a+++res
  LPERR04G18520.1 448 AAEIEASKLGCEAGEALAVNLAFALSHVPDESVSPANPRDETLRRVRALGPQVVALVEQEINSNTAPLATRFADACAHYGAILESLDATIARES 541
                      ********************************************************************************************** PP

             GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                       er+  E++ l+ ++ n+v  ega+r er+e ++kWr+r+++aGF+pv+l+  +a+q+ +    v+  g  v+ e+g l lgW++r ++++SaW
  LPERR04G18520.1 542 AERARAEAA-LAGRAANAVGREGADRLERCEVFGKWRARFGMAGFRPVALGPGIADQVLARSGPVA-AGLAVKAENGVLRLGWMGRVVTVASAW 633
                      *********.666678*****************************************988888888.99************************* PP

             GRAS 374 r 374
                      r
  LPERR04G18520.1 634 R 634
                      8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098543.379240615IPR005202Transcription factor GRAS
PfamPF035141.6E-88267634IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 634 aa     Download sequence    Send to blast
MEPGAPWRDP RQAYLYGVGS AVQMPMQQRS DAAAAAAVGG VLKRSLGEME RWQQHQQQQR  60
QVAMQQALYL RHVRQRTAAA SSAAAVSPLT SADIAAVLGG PPSQPLVLSG SSMGGPLGSP  120
SSTLSSLTTA SRAAVAMPLM QPQLQRQQMP YLAASSPHVQ SFGTARALAP PAAAVSDMSI  180
LQELEKQLLG DDDDVEAAMS GTGSAVTGSE WEEQLNSITA APWTRLPAAT TPNNNAVGMT  240
RSPSNSSTST ASSSASCSPP TSATTSRQLL SEAAAAIADG HHETAATHLA ALKRAANSRG  300
DVEQRLVAMM VAALSSRIAQ ASSSPSQHLQ ELCSAEQRAG SQLLHDISPC FRLALHAANV  360
AIVDAVGDHR AIHLVDFDVS APQQADLIRR LAARRLPGTS IRITAVTDPT SPFTQPLAAT  420
LPAVGEQLQK LAERAGIEYR FKMVSCRAAE IEASKLGCEA GEALAVNLAF ALSHVPDESV  480
SPANPRDETL RRVRALGPQV VALVEQEINS NTAPLATRFA DACAHYGAIL ESLDATIARE  540
SAERARAEAA LAGRAANAVG REGADRLERC EVFGKWRARF GMAGFRPVAL GPGIADQVLA  600
RSGPVAAGLA VKAENGVLRL GWMGRVVTVA SAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-392626341375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149600.0AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankAL6066880.0AL606688.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0064M23, complete sequence.
GenBankAK1002940.0AK100294.1 Oryza sativa Japonica Group cDNA clone:J023075P18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637100.10.0PREDICTED: scarecrow-like protein 8
TrEMBLA0A0D9W8I70.0A0A0D9W8I7_9ORYZ; Uncharacterized protein
STRINGBGIOSGA014504-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os04g49110.10.0(Oryza sativa Japonica Group)
STRINGORGLA04G0197700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.18e-74SCARECROW-like 8