PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR04G16750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family AP2
Protein Properties Length: 633aa    MW: 67826.4 Da    PI: 6.7694
Description AP2 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR04G16750.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP262.21.1e-19100151256
              AP2   2 gykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkklege 56 
                      +y+GVr+++ +g+++AeIrdp+ +g   r++lg+++t+ eAa+a+++a+ +++g+
  LPERR04G16750.1 100 KYRGVRQRP-WGKFAAEIRDPKRRG--SRVWLGTYDTPAEAARAYDRAAFRMRGA 151
                      8********.**********96554..**************************95 PP

2AP240.37.7e-13419456242
              AP2   2 gykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeA 42 
                      +y+GVr+++ +g+++AeIrdp+ +g   r++lg+++ta+ A
  LPERR04G16750.1 419 KYRGVRQRP-WGKFAAEIRDPKRRG--SRVWLGTYDTAFAA 456
                      8********.**********96554..**********8876 PP

3AP239.31.7e-124544931556
              AP2  15 WvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkklege 56 
                      ++AeIrdp+ +g   r++lg+++t+ eAa+a+++a+ +++g+
  LPERR04G16750.1 454 FAAEIRDPKRRG--SRVWLGTYDTPVEAARAYDRAAFRMRGA 493
                      68*****96554..**************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.730.109.0E-3299159IPR001471AP2/ERF domain
CDDcd000183.34E-28100160No hitNo description
PfamPF008471.0E-14100150IPR001471AP2/ERF domain
SuperFamilySSF541713.4E-22100159IPR016177DNA-binding domain
PROSITE profilePS5103224.368100158IPR001471AP2/ERF domain
SMARTSM003809.2E-37100164IPR001471AP2/ERF domain
PRINTSPR003677.6E-13101112IPR001471AP2/ERF domain
PRINTSPR003677.6E-13140160IPR001471AP2/ERF domain
Gene3DG3DSA:3.30.730.101.2E-17418455IPR001471AP2/ERF domain
PfamPF008474.4E-8419456IPR001471AP2/ERF domain
CDDcd000182.91E-25419502No hitNo description
SuperFamilySSF541717.85E-11419456IPR016177DNA-binding domain
PROSITE profilePS5103223.235419500IPR001471AP2/ERF domain
SMARTSM003802.0E-33419506IPR001471AP2/ERF domain
SuperFamilySSF541719.81E-15454501IPR016177DNA-binding domain
Gene3DG3DSA:3.30.730.108.5E-22456501IPR001471AP2/ERF domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 633 aa     Download sequence    Send to blast
MDFSIEFIRE HLLGGDAPVP VLPAAYPPTM FLPQQPRGYV DSAPAAEAAF RETEEMFMFG  60
DNMLSPVNTS SLTITPPPPS SFGWAAAPAM TPAVVEDFRK YRGVRQRPWG KFAAEIRDPK  120
RRGSRVWLGT YDTPAEAARA YDRAAFRMRG AKAILNFPND VGTHGADLLA PPPPTTSSSK  180
ATTETTKYKR KRQAAPEGHS VVEAVGVVNS KAAKTEAVTS YTSSLSSSSA SSMSRDTTAA  240
AAATSSSTGT SIGSWEAAGA GTESFPVTPS SWSCDQYWDA LVAYMDFHGD ADDFALELIR  300
EHLLGVDATT LPSPANLEAS VVDVTIPEPA ATYAPPAFFP QHEHHHHHHH QDCHVQATRE  360
SSRAPEVMIK FGGEPSPVSR QPSSLTITLP PRNSFGWAAP GAAGGAGAGA HAVAEDFRKY  420
RGVRQRPWGK FAAEIRDPKR RGSRVWLGTY DTAFAAEIRD PKRRGSRVWL GTYDTPVEAA  480
RAYDRAAFRM RGAKAILNFP NDIGTQGADL LAPPPAPPPT SNKRKRQSSS SDEDDGDVVE  540
VNSKAVKTEA PTSYTSSSLS SSSVSQDTTP ATSSTGNSTV STSEHAGAVD VSFPMTPSSW  600
SWEQYWDGLL GGLPPLSPLS PHPALGFPQL TVN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2gcc_A2e-2599500468ATERF1
3gcc_A2e-2599500468ATERF1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126123e-91CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635116.12e-88PREDICTED: ethylene-responsive transcription factor ERF105
TrEMBLA0A0D9W7U10.0A0A0D9W7U1_9ORYZ; Uncharacterized protein
STRINGORGLA04G0177300.14e-88(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP10337465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47230.16e-26ethylene responsive element binding factor 5