PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR04G10680.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MIKC_MADS
Protein Properties Length: 203aa    MW: 23447.2 Da    PI: 8.2265
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR04G10680.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.42.5e-251058250
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     rien   rqvtf+kRr g+lKKA+ELSvLCda++ vi+fs++gk+ye +
  LPERR04G10680.1 10 RIENPVHRQVTFCKRRMGLLKKAKELSVLCDADIGVIVFSPHGKIYELA 58
                     8*********************************************965 PP

2K-box60.76e-21901741699
            K-box  16 slqqelakLkkeienLqreqRhllGe.dLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                        qq++  L++e++ Lq+++Rh+ Ge d++ ++l eLq+Le++Le  + +iR++K++l+ ++ie l++ke  l+ +n +L++++ 
  LPERR04G10680.1  90 VVQQDVLFLRQEVDLLQNSLRHMYGEkDINHMNLGELQSLERNLEAWVHNIRTTKMQLMSREIEMLKNKEGILKAANDMLQERII 174
                      579**********************868*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554556.67E-28177IPR002100Transcription factor, MADS-box
SMARTSM004323.3E-35160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.24161IPR002100Transcription factor, MADS-box
CDDcd002656.74E-38271No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-26323IPR002100Transcription factor, MADS-box
PfamPF003194.3E-241056IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-263859IPR002100Transcription factor, MADS-box
PfamPF014861.6E-2484173IPR002487Transcription factor, K-box
PROSITE profilePS5129713.31888180IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MARGKVQMRR IENPVHRQVT FCKRRMGLLK KAKELSVLCD ADIGVIVFSP HGKIYELATN  60
GNMQGLIERY KGKNLSEVQV ESNEQNIPLV VQQDVLFLRQ EVDLLQNSLR HMYGEKDINH  120
MNLGELQSLE RNLEAWVHNI RTTKMQLMSR EIEMLKNKEG ILKAANDMLQ ERIIEQTGIL  180
DVGANIMIPQ VPLQLTTESN YYF
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR04G10680.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020194477.11e-119MADS-box transcription factor 26-like
RefseqXP_020194478.11e-119MADS-box transcription factor 26-like
SwissprotA2YQK92e-76MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G82e-76MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLA0A0D9W5F21e-147A0A0D9W5F2_9ORYZ; Uncharacterized protein
STRINGLPERR04G10680.11e-148(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.13e-59AGAMOUS-like 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Lee S, et al.
    Further characterization of a rice AGL12 group MADS-box gene, OsMADS26.
    Plant Physiol., 2008. 147(1): p. 156-68
    [PMID:18354041]
  3. Khong GN, et al.
    OsMADS26 Negatively Regulates Resistance to Pathogens and Drought Tolerance in Rice.
    Plant Physiol., 2015. 169(4): p. 2935-49
    [PMID:26424158]