PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR04G02520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family TCP
Protein Properties Length: 191aa    MW: 19420.8 Da    PI: 6.9728
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR04G02520.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP101.91.1e-3154121572
              TCP   5 kdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssase 72 
                       +++ ++h+kv gR+RRvR++a +aar+F+L++eLG+ +d++tieWLl+qa+p+i+++tgt+ +++++
  LPERR04G02520.1  54 PSSSTDRHSKVAGRGRRVRIPAMVAARVFQLTRELGHRTDGETIEWLLRQAEPSIIAATGTGVTPEEA 121
                      45778********************************************************7777733 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.2E-2756118IPR005333Transcription factor, TCP
PROSITE profilePS5136926.33557111IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MAASSSDLIL YNLVPSSSQP LNPSLPIPNP DLSISSSAAD VDATTRRVRA RKSPSSSTDR  60
HSKVAGRGRR VRIPAMVAAR VFQLTRELGH RTDGETIEWL LRQAEPSIIA ATGTGVTPEE  120
APPAAVPVAG GGGGAPSVAV AAAHGGPFVH VPYYTALLMQ PPNADEPPMA SAAAAAAAAA  180
SASVTTGEEN N
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633587.12e-77PREDICTED: transcription factor PCF1
SwissprotO238752e-77PCF1_ORYSJ; Transcription factor PCF1
TrEMBLA0A0D9W2J71e-133A0A0D9W2J7_9ORYZ; Uncharacterized protein
STRINGLOC_Os04g11830.15e-77(Oryza sativa Japonica Group)
STRINGORGLA04G0027800.15e-77(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141722627
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08330.16e-32TCP family protein