PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR03G26090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family GeBP
Protein Properties Length: 392aa    MW: 41922.7 Da    PI: 7.1527
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR03G26090.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57385.66.8e-2792186297
           DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskki 95 
                      +fqr+wse+De+ +LqGl+ +   +g+    d++ fy+ +++s+s  +++sql+eK+rrLK+Kf++ ++++ +g +p+  ++hd+++++l++++
  LPERR03G26090.1  92 KFQRIWSESDELRFLQGLLGC-GAQGMVFPRDLNVFYDRFSESMSQPYTRSQLSEKLRRLKNKFRGFSARIGRGLDPARLAPHDRDVLHLCSRL 184
                      79*******************.566888888*************************************************************** PP

           DUF573  96 Wg 97 
                      W+
  LPERR03G26090.1 185 WD 186
                      *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.0E-2493186IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MASDQTLPPV PLPFPLAAPN PDPSTPTAPP HLAADPTAPP PPPSSASAGA RKLPVKRRSP  60
PPRPSSPSSS SPVSSDPKNP HPQQPQQQPP FKFQRIWSES DELRFLQGLL GCGAQGMVFP  120
RDLNVFYDRF SESMSQPYTR SQLSEKLRRL KNKFRGFSAR IGRGLDPARL APHDRDVLHL  180
CSRLWDPANA STSPFGAAAS SPGGGEASSG NKRRRASSRA GAGQLMLPAA PSGDGNSHDY  240
NGISNGGTPA GAFPDGHGEE MMYLEQESGH FGYHGDAGIV ADESLHGIVK EQPEAMVAVP  300
NVGDVVVHNE NGNGNAVVPR SDEHHMANAV LDIFDECLRE VKANGVACGV NVDGSTKDNE  360
FAKRWRAQRM DELDVLSRRL RLLVEDAAAA GR
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR03G26090.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006651736.11e-174PREDICTED: uncharacterized protein LOC102711246
TrEMBLA0A0D9VY170.0A0A0D9VY17_9ORYZ; Uncharacterized protein
STRINGLPERR03G26090.10.0(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04930.22e-12DNA-binding storekeeper protein-related transcriptional regulator