PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR03G23450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family LBD
Protein Properties Length: 205aa    MW: 21500.5 Da    PI: 9.1135
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR03G23450.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.41.2e-43371361100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca++Cv+apyfp  +p+kfanvhk+FGasnv+kll+++p ++r da+sslvyeA+ar+rdP+yG+vg i++lq+q+e+l+++l
  LPERR03G23450.1  37 PCAACKLLRRRCAAGCVFAPYFPPGEPHKFANVHKVFGASNVSKLLQEIPVQHRGDAVSSLVYEANARVRDPIYGCVGAISSLQHQVENLQTQL 130
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      al+++e
  LPERR03G23450.1 131 ALAQAE 136
                      **9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.73736137IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-4337134IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MRDVMVAVSG GGKAASCRQA QGGGGGGGGA TASATAPCAA CKLLRRRCAA GCVFAPYFPP  60
GEPHKFANVH KVFGASNVSK LLQEIPVQHR GDAVSSLVYE ANARVRDPIY GCVGAISSLQ  120
HQVENLQTQL ALAQAEMVRL RMSNDYITRR LRVRRGGGGG GGSTTTGSPS SMTSPAKTAE  180
PEMLCKPNPE LDMVVDQPDF GFWSY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0699111e-115BT069911.1 Zea mays full-length cDNA clone ZM_BFb0321D10 mRNA, complete cds.
GenBankKJ7276501e-115KJ727650.1 Zea mays clone pUT5577 LOB transcription factor (LOB19) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629600.19e-98PREDICTED: LOB domain-containing protein 4
SwissprotQ8LBW33e-58LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0D9VX381e-151A0A0D9VX38_9ORYZ; Uncharacterized protein
STRINGBGIOSGA013249-PA3e-97(Oryza sativa Indica Group)
STRINGLOC_Os03g45750.13e-97(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.15e-47LBD family protein