PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR03G21590.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family LBD
Protein Properties Length: 274aa    MW: 29370.9 Da    PI: 7.0204
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR03G21590.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601361.4e-4271061100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++e+reda++sl+yeAear+rdPvyG+v+ i+ lq +++q++ +l
  LPERR03G21590.1   7 PCAACKLLRRKCTQGCVFAPYFPPDQPAKFANVHKVFGASNVTKLLNDLSPEQREDAVNSLAYEAEARLRDPVYGCVAYISVLQLRIKQVRDQL 100
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      + +++e
  LPERR03G21590.1 101 VDARKE 106
                      999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8336107IPR004883Lateral organ boundaries, LOB
PfamPF031954.1E-427103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MSSSSSPCAA CKLLRRKCTQ GCVFAPYFPP DQPAKFANVH KVFGASNVTK LLNDLSPEQR  60
EDAVNSLAYE AEARLRDPVY GCVAYISVLQ LRIKQVRDQL VDARKELSNY IGPNAAFLPA  120
AAPHPYLAGV AAADPHHHYH QAGLVAAGYA PQMQHQMAGL HVQQQQQIAA IGVARDHQEM  180
MRARHAAAAA AYAQVQAATV AVEAETFDGG PAFLLHQQQP PSSEPAMALP YRMEPSPPQP  240
SSGHSHDEVS QQHHRHHPHA DGSDEGSGGG APPG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126111e-136CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
GenBankAC1369721e-136AC136972.3 Oryza sativa chromosome 3 BAC OSJNBb0007E22 genomic sequence, complete sequence.
GenBankAP0149591e-136AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015629364.11e-109PREDICTED: LOB domain-containing protein 36
TrEMBLA0A0D9VWD80.0A0A0D9VWD8_9ORYZ; Uncharacterized protein
STRINGORGLA03G0240600.11e-110(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61433456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.16e-61ASYMMETRIC LEAVES 2-like 1