PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR03G12870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 167aa    MW: 18233.1 Da    PI: 9.1425
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR03G12870.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.92.6e-092671550
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50
                     +   rk +NR++A++sR +K+++++ L+ ++++L  eN+a +  + 
  LPERR03G12870.1 26 RQRNRKRSNRLSAQKSRMKKQQYVDGLAAEAEQLRRENDAVRAAAA 71
                     33447789*******************************9987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.2E-102171No hitNo description
SMARTSM003385.5E-112186IPR004827Basic-leucine zipper domain
PfamPF001701.8E-62469IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.6222467IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.05E-72674No hitNo description
CDDcd147021.30E-102764No hitNo description
PROSITE patternPS0003603044IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 167 aa     Download sequence    Send to blast
MSVAPAPESG AARRAAAAAA AKEEERQRNR KRSNRLSAQK SRMKKQQYVD GLAAEAEQLR  60
RENDAVRAAA AASLRRCRLV EQENRALMTH ALQLRGSLLR LLGEVAGVPL DVPDVADHLV  120
QLYGGGLPMM PPLSGPPPLP PEIEMLLFQL QPDVMDAVSM LQDYVSM
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR03G12870.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1347692e-70AC134769.1 Genomic sequence for Oryza sativa, Nipponbare strain, clone OJ1145F05, from chromosome 3, complete sequence.
GenBankAK1099292e-70AK109929.1 Oryza sativa Japonica Group cDNA clone:002-151-H09, full insert sequence.
GenBankAP0149592e-70AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankCP0126112e-70CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631799.14e-60ocs element-binding factor 1
TrEMBLA0A0D9VT671e-113A0A0D9VT67_9ORYZ; Uncharacterized protein
STRINGLPERR03G12870.11e-114(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP125042837