PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR03G05830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family HD-ZIP
Protein Properties Length: 289aa    MW: 31743.7 Da    PI: 4.3299
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR03G05830.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.92e-1957109456
                      -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      ++++  eq+++Le+ Fe +++++ ++++++A+ lgL+ rqV vWFqNrRa++k
  LPERR03G05830.1  57 KRRLAVEQVRALERSFETDNKLDPDRKARIARDLGLQPRQVAVWFQNRRARWK 109
                      457889**********************************************9 PP

2HD-ZIP_I/II129.61.2e-4155147193
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                      ekkrrl+ eqv++LE+sFe+++kL+p+rK+++ar+LglqprqvavWFqnrRAR+ktkqlE+d+++L++++dal+++ ++L++++++L++e++e
  LPERR03G05830.1  55 EKKRRLAVEQVRALERSFETDNKLDPDRKARIARDLGLQPRQVAVWFQNRRARWKTKQLERDFASLRARHDALRSDCDALRRDKDALAAEIRE 147
                      69**************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.35E-1948113IPR009057Homeodomain-like
SMARTSM003891.0E-1954115IPR001356Homeobox domain
PROSITE profilePS5007116.64955111IPR001356Homeobox domain
CDDcd000863.08E-1856112No hitNo description
PfamPF000461.2E-1657109IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.4E-2063110IPR009057Homeodomain-like
PRINTSPR000312.5E-58291IPR000047Helix-turn-helix motif
PROSITE patternPS00027086109IPR017970Homeobox, conserved site
PRINTSPR000312.5E-591107IPR000047Helix-turn-helix motif
PfamPF021831.3E-15111152IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MYTNFAGEKQ VFAEENSLLA ATMEQQDEAG VEVDDDGDDE DEDMARPSSL CGLGEKKRRL  60
AVEQVRALER SFETDNKLDP DRKARIARDL GLQPRQVAVW FQNRRARWKT KQLERDFASL  120
RARHDALRSD CDALRRDKDA LAAEIRELRE KLLAKPPSAA VSVKAEAGSD ANVAVGDSGA  180
TTVCKDGGSS DDSDTSVVVN DEQQQEEPGF VGFGASSFLV DPKWHGAYSY ESYKVGGYGF  240
TEEWLAASGE IGNDEVAASF FSDEHASSNL INFGWCASGN EGWDLGVRL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1103111RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR03G05830.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0601191e-136AK060119.1 Oryza sativa Japonica Group cDNA clone:006-308-F01, full insert sequence.
GenBankAK1015221e-136AK101522.1 Oryza sativa Japonica Group cDNA clone:J033046N04, full insert sequence.
GenBankAK1016011e-136AK101601.1 Oryza sativa Japonica Group cDNA clone:J033051J21, full insert sequence.
GenBankAK1056441e-136AK105644.1 Oryza sativa Japonica Group cDNA clone:001-200-F05, full insert sequence.
GenBankAY5540321e-136AY554032.1 Oryza sativa (japonica cultivar-group) clone R10191 Hox13 (hox13) mRNA, partial cds.
GenBankCT8310391e-136CT831039.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA023E12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006649529.11e-119PREDICTED: homeobox-leucine zipper protein HOX13-like
SwissprotQ10QP31e-105HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLA0A0D9VQI80.0A0A0D9VQI8_9ORYZ; Uncharacterized protein
STRINGLPERR03G05830.10.0(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.23e-35homeobox protein 5
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]