PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR02G31960.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 132aa    MW: 14425.4 Da    PI: 9.7924
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR02G31960.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_152.21.4e-1658117160
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                      e+e ++++r++kNRe+A rsR+RK+a+++eLe++v  L +eN +Lk   ++lk e+a+l 
  LPERR02G31960.1  58 EEEERKTIRMMKNRESALRSRARKRAYVQELEKEVRRLVNENLKLKRHCKQLKTEMAALI 117
                      678899***********************************************9999885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.0E-1656117No hitNo description
PRINTSPR000411.5E-55773IPR001630cAMP response element binding (CREB) protein
PfamPF001705.2E-1458116IPR004827Basic-leucine zipper domain
SMARTSM003387.2E-1458122IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.50760116IPR004827Basic-leucine zipper domain
CDDcd147071.39E-1462116No hitNo description
SuperFamilySSF579599.0E-1362118No hitNo description
PRINTSPR000411.5E-57595IPR001630cAMP response element binding (CREB) protein
PRINTSPR000411.5E-595112IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MAEQLGSPQL SLSSCSSFLS ISSAAADGAP HLSLGAGGGE ELDLLMQVGI GGGGGDEEEE  60
ERKTIRMMKN RESALRSRAR KRAYVQELEK EVRRLVNENL KLKRHCKQLK TEMAALIQPT  120
TKQSSHRRSS ST
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for the transition to flowering promoted by FT. {ECO:0000269|PubMed:16099979, ECO:0000269|PubMed:16099980}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLPERR02G31960.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0610861e-129AK061086.1 Oryza sativa Japonica Group cDNA clone:006-206-G05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006648186.12e-55PREDICTED: protein FD-like
SwissprotQ84JK23e-12FD_ARATH; Protein FD
TrEMBLA0A0D9VN603e-89A0A0D9VN60_9ORYZ; Uncharacterized protein
STRINGLPERR02G31960.15e-90(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40173072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.13e-13bZIP family protein
Publications ? help Back to Top
  1. Ho WW,Weigel D
    Structural features determining flower-promoting activity of Arabidopsis FLOWERING LOCUS T.
    Plant Cell, 2014. 26(2): p. 552-64
    [PMID:24532592]
  2. Ji H, et al.
    Downregulation of leaf flavin content induces early flowering and photoperiod gene expression in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 237
    [PMID:25201173]
  3. Li L, et al.
    Expression of turtle riboflavin-binding protein represses mitochondrial electron transport gene expression and promotes flowering in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 381
    [PMID:25547226]
  4. Sussmilch FC, et al.
    Pea VEGETATIVE2 Is an FD Homolog That Is Essential for Flowering and Compound Inflorescence Development.
    Plant Cell, 2015. 27(4): p. 1046-60
    [PMID:25804541]
  5. Khan M, et al.
    Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis.
    Plant Physiol., 2015. 169(3): p. 2166-86
    [PMID:26417006]
  6. Andrés F, et al.
    Floral Induction in Arabidopsis by FLOWERING LOCUS T Requires Direct Repression of BLADE-ON-PETIOLE Genes by the Homeodomain Protein PENNYWISE.
    Plant Physiol., 2015. 169(3): p. 2187-99
    [PMID:26417007]
  7. Kawamoto N,Endo M,Araki T
    Expression of a kinase-dead form of CPK33 involved in florigen complex formation causes delayed flowering.
    Plant Signal Behav, 2015. 10(12): p. e1086856
    [PMID:26440648]
  8. Zhang L,Yu H,Lin S,Gao Y
    Molecular Characterization of FT and FD Homologs from Eriobotrya deflexa Nakai forma koshunensis.
    Front Plant Sci, 2016. 7: p. 8
    [PMID:26834775]
  9. Hou CJ,Yang CH
    Comparative analysis of the pteridophyte Adiantum MFT ortholog reveals the specificity of combined FT/MFT C and N terminal interaction with FD for the regulation of the downstream gene AP1.
    Plant Mol. Biol., 2016. 91(4-5): p. 563-79
    [PMID:27216814]
  10. Jung JH,Lee HJ,Ryu JY,Park CM
    SPL3/4/5 Integrate Developmental Aging and Photoperiodic Signals into the FT-FD Module in Arabidopsis Flowering.
    Mol Plant, 2016. 9(12): p. 1647-1659
    [PMID:27815142]
  11. Jang S,Li HY,Kuo ML
    Ectopic expression of Arabidopsis FD and FD PARALOGUE in rice results in dwarfism with size reduction of spikelets.
    Sci Rep, 2017. 7: p. 44477
    [PMID:28290557]