PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR02G22810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family GRAS
Protein Properties Length: 559aa    MW: 58385.1 Da    PI: 9.6256
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR02G22810.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS86.73.7e-272583912144
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                      ++lL e+A a+++g+++ a + L++l+  a+p+gd+ qRl+a ++ A+++r+           p+++ ++  + e+ aa +l+++vsP++ ++ 
  LPERR02G22810.1 258 RQLLSEAAAAIADGNHKSAASHLSTLKLAANPRGDAEQRLVAIMVAAMSSRVGA--------APTQNLTDIYTGEHRAACQLLQDVSPCFGLAL 343
                      689*************************************************98........6677777667899999**************** PP

             GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRi 144
                        aN aI +av+g++++H +Dfd+s  +Q +aL++aLa+R+ ++ sl++
  LPERR02G22810.1 344 HGANLAIIDAVAGHRAIHLVDFDVSA-AQHVALIKALADRRLPATSLKL 391
                      ************************85.8*************99999997 PP

2GRAS1202.9e-37390558193373
             GRAS 193 eLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                      +L ++pgEalaVnl++ l r++desvs +++rde+L+ v+ l P+vv++veqe   nse          + + a++d l+a+l+r+s er+  E
  LPERR02G22810.1 390 KLGCEPGEALAVNLAFTLSRVPDESVSPANPRDELLRRVRALGPRVVTLVEQEFISNSE----------HEHGAVLDLLDATLGRDSAERARAE 473
                      6899*************************************************987665..........7899********************* PP

             GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                      ++ l+ ++ n+v  eg +r+er+e ++kWr r+++aGF++v+++e++a  +++ l       + v+ ++g l  gW++r ++++SaW
  LPERR02G22810.1 474 AA-LAGKVANAVGREGPDRVERCEVFGKWRPRFGMAGFRAVAIGENVAGRVRARLGPLL-PAFDVKVDNGRLGVGWMGRVVTVASAW 558
                      **.9999************************************************9999.66************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098515.652231559IPR005202Transcription factor GRAS
PfamPF035149.9E-35390558IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
MDPAGAPWRD PRRAYGGYAV GSTTAKQATA RQQSQQPRSD ARGGAAAVTG GVLKRSLGEM  60
EMWQQQKAMY LRSVRQRAGA LQPMGIGGLL GGVTSPSPSR AYGISALSPG FGGISPQLSS  120
LTTASRTVVP GFQHLQRQMM AAPAVQSQVV ARGPVSRPAT ASELVLLQEL EKQLLDDDYD  180
ATDKEGSTCG SGVTTSDWGD TIQKLNSITA ASSPSPPLPT TAVNKTAALL SLSPTNSSSS  240
TASSSASSSP PIPTASSRQL LSEAAAAIAD GNHKSAASHL STLKLAANPR GDAEQRLVAI  300
MVAAMSSRVG AAPTQNLTDI YTGEHRAACQ LLQDVSPCFG LALHGANLAI IDAVAGHRAI  360
HLVDFDVSAA QHVALIKALA DRRLPATSLK LGCEPGEALA VNLAFTLSRV PDESVSPANP  420
RDELLRRVRA LGPRVVTLVE QEFISNSEHE HGAVLDLLDA TLGRDSAERA RAEAALAGKV  480
ANAVGREGPD RVERCEVFGK WRPRFGMAGF RAVAIGENVA GRVRARLGPL LPAFDVKVDN  540
GRLGVGWMGR VVTVASAWH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623156.10.0PREDICTED: scarecrow-like protein 8
TrEMBLA0A0D9VJJ30.0A0A0D9VJJ3_9ORYZ; Uncharacterized protein
STRINGLOC_Os02g45760.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.11e-68SCARECROW-like 8